Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PTEN is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human PTEN Monoclonal Antibody | anti-PTEN antibody

PTEN (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and Dual-specificity Protein Phosphatase PTEN, Mutated in Multiple Advanced Cancers 1, Phosphatase and Tensin Homolog, MMAC1, TEP1, MGC11227) (HRP)

Gene Names
PTEN; BZS; DEC; CWS1; GLM2; MHAM; TEP1; MMAC1; PTEN1; 10q23del; PTENbeta
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PTEN; Monoclonal Antibody; PTEN (Phosphatidylinositol 3; 4; 5-trisphosphate 3-phosphatase and Dual-specificity Protein Phosphatase PTEN; Mutated in Multiple Advanced Cancers 1; Phosphatase and Tensin Homolog; MMAC1; TEP1; MGC11227) (HRP); anti-PTEN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G9
Specificity
Recognizes human PTEN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2357
Applicable Applications for anti-PTEN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa221-320, from human PTEN (AAH05821) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PTEN is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PTEN is ~0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PDGFRB and PTEN HeLa cells were stained with PDGFRB rabbit purified polyclonal 1:1200 and PTEN mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit and nuclei were counterstained with each red dot represents the detection of protein-protein interaction complex)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between PDGFRB and PTEN HeLa cells were stained with PDGFRB rabbit purified polyclonal 1:1200 and PTEN mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit and nuclei were counterstained with each red dot represents the detection of protein-protein interaction complex)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PXN and PTEN Mahlavu cells were stained with PXN rabbit purified polyclonal 1:1200 and PTEN mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit and nuclei were counterstained with each red dot represents the detection of protein-protein interaction complex)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between PXN and PTEN Mahlavu cells were stained with PXN rabbit purified polyclonal 1:1200 and PTEN mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit and nuclei were counterstained with each red dot represents the detection of protein-protein interaction complex)
Related Product Information for anti-PTEN antibody
The tumor suppressor phosphatase PTEN regulates cell migration, growth, and survival by dephosphorylating phosphatidylinositol second messengers and signaling phosphoproteins. PTEN protein is composed of an N-terminal dual specificity phosphatase-like enzyme domain and C-terminal noncatalytic regulatory domain that contains multiple putative phosphorylation sites, which could play an important role in the control of its biological activity. Proper phosphorylation of PTEN by CK2 is important for PTEN protein stability to proteasome-mediated degradation. The phosphorylation sites in PTEN are located within a C- terminal cluster of Ser/Thr residues. The CK2 phosphorylation sites were identified as PTEN residues Ser-370, Ser-380, Thr-382, Thr-383, and Ser-385.
Product Categories/Family for anti-PTEN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens phosphatase and tensin homolog, mRNA
NCBI Official Synonym Full Names
phosphatase and tensin homolog
NCBI Official Symbol
PTEN
NCBI Official Synonym Symbols
BZS; DEC; CWS1; GLM2; MHAM; TEP1; MMAC1; PTEN1; 10q23del; PTENbeta
NCBI Protein Information
phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN

NCBI Description

This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded by this gene is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway. The use of a non-canonical (CUG) upstream initiation site produces a longer isoform that initiates translation with a leucine, and is thought to be preferentially associated with the mitochondrial inner membrane. This longer isoform may help regulate energy metabolism in the mitochondria. A pseudogene of this gene is found on chromosome 9. Alternative splicing and the use of multiple translation start codons results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2015]

Research Articles on PTEN

Similar Products

Product Notes

The PTEN (Catalog #AAA6154414) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTEN (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and Dual-specificity Protein Phosphatase PTEN, Mutated in Multiple Advanced Cancers 1, Phosphatase and Tensin Homolog, MMAC1, TEP1, MGC11227) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTEN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTEN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTEN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.