Mouse anti-Human PTBP1 Monoclonal Antibody | anti-PTBP1 antibody

PTBP1 (Polypyrimidine Tract-binding Protein 1, PTB, Heterogeneous Nuclear Ribonucleoprotein I, hnRNP I, 57kD RNA-binding Protein PPTB-1, MGC10830, MGC8461) (Biotin)

Cat. Num. AAA6143805

• Gene Names: PTBP1; PTB; PTB2; PTB3; PTB4; pPTB; HNRPI; PTB-1; PTB-T; HNRNPI; HNRNP-I
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTBP1; Monoclonal Antibody; PTBP1 (Polypyrimidine Tract-binding Protein 1; PTB; Heterogeneous Nuclear Ribonucleoprotein I; hnRNP I; 57kD RNA-binding Protein PPTB-1; MGC10830; MGC8461) (Biotin); anti-PTBP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3H8
• Specificity: Recognizes human PTBP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PTBP1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa45-145, from human PTBP1 (NP_002810) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQ
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PTBP1 monoclonal antibody, Western Blot analysis of PTBP1 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of PTBP1 expression in transfected 293T cell line by PTBP1 monoclonal antibody, Lane 1: PTBP1 transfected lysate (59.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PTBP1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PTBP1 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of PTBP1 transfected lysate using PTBP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PTBP1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged PTBP1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-PTBP1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4506243
• NCBI GeneID: 5725
• NCBI Accession #: NP_002810
• NCBI GenBank Nucleotide #: NM_002819
• UniProt Accession #: Q9BUQ0; P26599
• Molecular Weight: 59,633 Da
• NCBI Official Full Name: polypyrimidine tract-binding protein 1 isoform a
• NCBI Official Synonym Full Names: polypyrimidine tract binding protein 1
• NCBI Official Symbol: PTBP1
• NCBI Official Synonym Symbols: PTB; PTB2; PTB3; PTB4; pPTB; HNRPI; PTB-1; PTB-T; HNRNPI; HNRNP-I
• NCBI Protein Information: polypyrimidine tract-binding protein 1; 57 kDa RNA-binding protein PPTB-1; heterogeneous nuclear ribonucleoprotein I; heterogeneous nuclear ribonucleoprotein polypeptide I; hnRNP I; polypyrimidine tract binding protein (heterogeneous nuclear ribonucleopro
• UniProt Protein Name: Polypyrimidine tract-binding protein 1
• Protein Family: Polypyrimidine tract-binding protein
• UniProt Gene Name: PTBP1
• UniProt Synonym Gene Names: PTB; PTB; hnRNP I
• UniProt Entry Name: PTBP1_HUMAN