Mouse anti-Human PSMG1 Monoclonal Antibody | anti-PSMG1 antibody

PSMG1 (Proteasome Assembly Chaperone 1, PAC-1, Chromosome 21 Leucine-rich Protein, C21-LRP, Down Syndrome Critical Region Protein 2, C21LRP, DSCR2, PAC1)

Cat. Num. AAA645546

• Gene Names: PSMG1; PAC1; DSCR2; PAC-1; C21LRP; LRPC21
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PSMG1; Monoclonal Antibody; PSMG1 (Proteasome Assembly Chaperone 1; PAC-1; Chromosome 21 Leucine-rich Protein; C21-LRP; Down Syndrome Critical Region Protein 2; C21LRP; DSCR2; PAC1); Anti -PSMG1 (Proteasome Assembly Chaperone 1; anti-PSMG1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F2
• Specificity: Recognizes human DSCR2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILS

• Applicable Applications for anti-PSMG1 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Full length recombinant corresponding to aa1-288 from DSCR2 (AAH03619) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DSCR2 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-PSMG1 antibody

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.

Product Categories/Family for anti-PSMG1 antibody

Antibodies; Abs to Proteasomes

NCBI and Uniprot Product Information

• NCBI GI #: 387849314
• NCBI GeneID: 8624
• NCBI Accession #: NP_001248753.1
• NCBI GenBank Nucleotide #: NM_001261824.1
• UniProt Accession #: O95456; Q6FHA3; Q6FHD3; Q6S713; B5BUN2
• Molecular Weight: 32,854 Da
• NCBI Official Full Name: proteasome assembly chaperone 1 isoform 3
• NCBI Official Synonym Full Names: proteasome (prosome, macropain) assembly chaperone 1
• NCBI Official Symbol: PSMG1
• NCBI Official Synonym Symbols: PAC1; DSCR2; PAC-1; C21LRP; LRPC21
• NCBI Protein Information: proteasome assembly chaperone 1; leucine rich protein C21-LRP; proteasome assembling chaperone 1; chromosome 21 leucine-rich protein; Down syndrome critical region gene 2; Down syndrome critical region protein 2
• UniProt Protein Name: Proteasome assembly chaperone 1
• Protein Family: Proteasome assembly chaperone
• UniProt Gene Name: PSMG1
• UniProt Synonym Gene Names: C21LRP; DSCR2; PAC1; PAC-1; C21-LRP
• UniProt Entry Name: PSMG1_HUMAN

Uniprot Description

DSCR2: Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization. Belongs to the PSMG1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: endoplasmic reticulum; cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: granule cell precursor proliferation; proteasome assembly