Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged DSCR2 is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human PSMG1 Monoclonal Antibody | anti-PSMG1 antibody

PSMG1 (Proteasome Assembly Chaperone 1, PAC-1, Chromosome 21 Leucine-rich Protein, C21-LRP, Down Syndrome Critical Region Protein 2, C21LRP, DSCR2, PAC1) (FITC)

Gene Names
PSMG1; PAC1; DSCR2; PAC-1; C21LRP; LRPC21
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PSMG1; Monoclonal Antibody; PSMG1 (Proteasome Assembly Chaperone 1; PAC-1; Chromosome 21 Leucine-rich Protein; C21-LRP; Down Syndrome Critical Region Protein 2; C21LRP; DSCR2; PAC1) (FITC); anti-PSMG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F2
Specificity
Recognizes human DSCR2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PSMG1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-288 from DSCR2 (AAH03619) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DSCR2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DSCR2 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-PSMG1 antibody
Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.
Product Categories/Family for anti-PSMG1 antibody
References
1. Aging and dietary restriction alter proteasome biogenesis and composition in the brain and liver. Dasuri K, Zhang L, Ebenezer P, Liu Y, Fernandez-Kim SO, Keller JN.Mech Ageing Dev. 2009 Nov-Dec;130(11-12):777-83. 2. Down syndrome critical region 2 protein inhibits the transcriptional activity of peroxisome proliferator-activated receptor beta in HEK293 cells. Song HJ, Park J, Seo SR, Kim J, Paik SR, Chung KC.Biochem Biophys Res Commun. 2008 Nov 21;376(3):478-82. Epub 2008 Sep 13.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
30,288 Da
NCBI Official Full Name
Homo sapiens proteasome (prosome, macropain) assembly chaperone 1, mRNA
NCBI Official Synonym Full Names
proteasome assembly chaperone 1
NCBI Official Symbol
PSMG1
NCBI Official Synonym Symbols
PAC1; DSCR2; PAC-1; C21LRP; LRPC21
NCBI Protein Information
proteasome assembly chaperone 1
UniProt Protein Name
Proteasome assembly chaperone 1
UniProt Gene Name
PSMG1
UniProt Synonym Gene Names
C21LRP; DSCR2; PAC1; PAC-1; C21-LRP
UniProt Entry Name
PSMG1_HUMAN

Uniprot Description

DSCR2: Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization. Belongs to the PSMG1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: endoplasmic reticulum; cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: granule cell precursor proliferation; proteasome assembly

Research Articles on PSMG1

Similar Products

Product Notes

The PSMG1 psmg1 (Catalog #AAA6146916) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PSMG1 (Proteasome Assembly Chaperone 1, PAC-1, Chromosome 21 Leucine-rich Protein, C21-LRP, Down Syndrome Critical Region Protein 2, C21LRP, DSCR2, PAC1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSMG1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PSMG1 psmg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PSMG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.