Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PSME2 Monoclonal Antibody | anti-PSME2 antibody

PSME2 (Proteasome Activator Complex Subunit 2, Proteasome Activator 28 Subunit beta, PA28beta, PA28b, Activator Of Multicatalytic Protease Subunit 2, 11S Regulator Complex Subunit beta, REG-beta) (MaxLight 405)

Gene Names
PSME2; PA28B; REGbeta; PA28beta
Reactivity
Human
Applications
Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PSME2; Monoclonal Antibody; PSME2 (Proteasome Activator Complex Subunit 2; Proteasome Activator 28 Subunit beta; PA28beta; PA28b; Activator Of Multicatalytic Protease Subunit 2; 11S Regulator Complex Subunit beta; REG-beta) (MaxLight 405); anti-PSME2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G4
Specificity
Recognizes human PSME2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-PSME2 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 6ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-91, from human PSME2 (NP_002809) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHK
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-PSME2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
proteasome activator complex subunit 2
NCBI Official Synonym Full Names
proteasome activator subunit 2
NCBI Official Symbol
PSME2
NCBI Official Synonym Symbols
PA28B; REGbeta; PA28beta
NCBI Protein Information
proteasome activator complex subunit 2
UniProt Protein Name
Proteasome activator complex subunit 2
UniProt Gene Name
PSME2
UniProt Synonym Gene Names
REG-beta; PA28b; PA28beta
UniProt Entry Name
PSME2_HUMAN

NCBI Description

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the beta subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13. [provided by RefSeq, Jul 2008]

Uniprot Description

PSME2: Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome. Heterodimer of PSME1 and PSME2, which forms a hexadimeric ring. By IFNG/IFN-gamma. Belongs to the PA28 family.

Protein type: Proteasome complex; Protease

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: nucleoplasm; proteasome complex; proteasome activator complex; membrane; cytosol

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; viral reproduction; apoptosis; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression; mitotic cell cycle; regulation of amino acid metabolic process; negative regulation of apoptosis; G1/S transition of mitotic cell cycle

Research Articles on PSME2

Similar Products

Product Notes

The PSME2 psme2 (Catalog #AAA6192061) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PSME2 (Proteasome Activator Complex Subunit 2, Proteasome Activator 28 Subunit beta, PA28beta, PA28b, Activator Of Multicatalytic Protease Subunit 2, 11S Regulator Complex Subunit beta, REG-beta) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSME2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 6ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PSME2 psme2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PSME2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.