Mouse anti-Human PSMD10 Monoclonal Antibody | anti-PSMD10 antibody

PSMD10 (26S Proteasome Non-ATPase Regulatory Subunit 10, 26S Proteasome Regulatory Subunit p28, Gankyrin, p28(GANK)) APC

Cat. Num. AAA6138493

• Gene Names: PSMD10; p28; p28(GANK); dJ889N15.2
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PSMD10; Monoclonal Antibody; PSMD10 (26S Proteasome Non-ATPase Regulatory Subunit 10; 26S Proteasome Regulatory Subunit p28; Gankyrin; p28(GANK)) APC; anti-PSMD10 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4B5
• Specificity: Recognizes human PSMD10.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-PSMD10 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa127-226, from human PSMD10 (AAH11960) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PSMD10 monoclonal antibody, Western Blot analysis of PSMD10 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of PSMD10 expression in transfected 293T cell line by PSMD10 monoclonal antibody, Lane 1: PSMD10 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PSMD10 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PSMD10 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PSMD10 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-PSMD10 antibody

Antibodies; Proteasomes

NCBI and Uniprot Product Information

• NCBI GI #: 15080416
• NCBI GeneID: 5716
• Molecular Weight: 16,137 Da
• NCBI Official Full Name: Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 10, mRNA
• NCBI Official Synonym Full Names: proteasome 26S subunit, non-ATPase 10
• NCBI Official Symbol: PSMD10
• NCBI Official Synonym Symbols: p28; p28(GANK); dJ889N15.2
• NCBI Protein Information: 26S proteasome non-ATPase regulatory subunit 10
• Protein Family: 26S proteasome non-ATPase regulatory

NCBI Description

This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression of this gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20.[provided by RefSeq, Mar 2011]