Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PSMC6 monoclonal antibody. Western Blot analysis of PSMC6 expression in PC-12.)

Mouse PSMC6 Monoclonal Antibody | anti-PSMC6 antibody

PSMC6 (26S Protease Regulatory Subunit 10B, Proteasome 26S Subunit ATPase 6, 26S Proteasome AAA-ATPase Subunit RPT4, Proteasome Subunit p42, SUG2) (AP)

Gene Names
PSMC6; P44; p42; SUG2; CADP44; HEL-S-73
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PSMC6; Monoclonal Antibody; PSMC6 (26S Protease Regulatory Subunit 10B; Proteasome 26S Subunit ATPase 6; 26S Proteasome AAA-ATPase Subunit RPT4; Proteasome Subunit p42; SUG2) (AP); anti-PSMC6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C4
Specificity
Recognizes human PSMC6. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PSMC6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa290-390, from human PSMC6 (AAH05390) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PSMC6 monoclonal antibody. Western Blot analysis of PSMC6 expression in PC-12.)

Western Blot (WB) (PSMC6 monoclonal antibody. Western Blot analysis of PSMC6 expression in PC-12.)

Western Blot (WB)

(PSMC6 monoclonal antibody Western Blot analysis of PSMC6 expression in Hela NE.)

Western Blot (WB) (PSMC6 monoclonal antibody Western Blot analysis of PSMC6 expression in Hela NE.)

Western Blot (WB)

(PSMC6 monoclonal antibody. Western Blot analysis of PSMC6 expression in NIH/3T3.)

Western Blot (WB) (PSMC6 monoclonal antibody. Western Blot analysis of PSMC6 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of PSMC6 expression in transfected 293T cell line by PSMC6 monoclonal antibody. Lane 1: PSMC6 transfected lysate (44.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PSMC6 expression in transfected 293T cell line by PSMC6 monoclonal antibody. Lane 1: PSMC6 transfected lysate (44.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PSMC6 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PSMC6 on HeLa cell. [antibody concentration 10ug/ml])

Western Blot (WB)

(Western blot analysis of PSMC6 over-expressed 293 cell line, cotransfected with PSMC6 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PSMC6 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PSMC6 over-expressed 293 cell line, cotransfected with PSMC6 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PSMC6 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-PSMC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
44,173 Da
NCBI Official Full Name
Homo sapiens proteasome (prosome, macropain) 26S subunit, ATPase, 6, mRNA
NCBI Official Synonym Full Names
proteasome 26S subunit, ATPase 6
NCBI Official Symbol
PSMC6
NCBI Official Synonym Symbols
P44; p42; SUG2; CADP44; HEL-S-73
NCBI Protein Information
26S protease regulatory subunit 10B
Protein Family

NCBI Description

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq, Jul 2008]

Research Articles on PSMC6

Similar Products

Product Notes

The PSMC6 (Catalog #AAA6133189) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PSMC6 (26S Protease Regulatory Subunit 10B, Proteasome 26S Subunit ATPase 6, 26S Proteasome AAA-ATPase Subunit RPT4, Proteasome Subunit p42, SUG2) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PSMC6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PSMC6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PSMC6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.