Mouse anti-Human PRSS50 Monoclonal Antibody | anti-PRSS50 antibody

PRSS50 (Probable Threonine Protease PRSS50, Cancer/testis Antigen 20, CT20, Serine Protease 50, Testis-specific Protease-like Protein 50, TSP50) (MaxLight 490)

Cat. Num. AAA6203891

• Reactivity: Human
• Applications: FLISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRSS50; Monoclonal Antibody; PRSS50 (Probable Threonine Protease PRSS50; Cancer/testis Antigen 20; CT20; Serine Protease 50; Testis-specific Protease-like Protein 50; TSP50) (MaxLight 490); EC=3.4.25.-; anti-PRSS50 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D8
• Specificity: Recognizes human TSP50.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
• Sequence Length: 385

• Applicable Applications for anti-PRSS50 antibody: FLISA
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa214-314 from human TSP50 (NP_037402) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QELKYSNYVRPICLPGTDYVLKDHSRCTVTGWGLSKADGMWPQFRTIQEKEVIILNNKECDNFYHNFTKIPTLVQIIKSQMMCAEDTHREKFCYELTGEP*
• Conjugate: MaxLight490
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-PRSS50 antibody

MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.

Product Categories/Family for anti-PRSS50 antibody

Antibodies; Enzymes; Protease (Proteinase; Peptidase)

NCBI and Uniprot Product Information

• NCBI GI #: 7019563
• NCBI Accession #: NP_037402
• NCBI GenBank Nucleotide #: NM_013270
• UniProt Accession #: Q9UI38
• NCBI Official Full Name: probable threonine protease PRSS50
• UniProt Protein Name: Probable threonine protease PRSS50
• Protein Family: Probable threonine protease
• UniProt Gene Name: PRSS50
• UniProt Synonym Gene Names: CT20; TSP50
• UniProt Entry Name: TSP50_HUMAN

Uniprot Description

TSP50: May be involved in proteolysis through its threonine endopeptidase activity. Belongs to the peptidase S1 family.

Protein type: EC 3.4.25.-; Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: endoplasmic reticulum; cytoplasm

Molecular Function: threonine endopeptidase activity; serine-type endopeptidase activity

Biological Process: proteolysis