Mouse anti-Human PRSS21 Monoclonal Antibody | anti-PRSS21 antibody

PRSS21 (ESP1, TEST1, Testisin, Eosinophil Serine Protease 1, Serine Protease 21) (FITC)

Cat. Num. AAA6149078

• Gene Names: PRSS21; ESP1; ESP-1; TEST1; TESTISIN
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRSS21; Monoclonal Antibody; PRSS21 (ESP1; TEST1; Testisin; Eosinophil Serine Protease 1; Serine Protease 21) (FITC); anti-PRSS21 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E10
• Specificity: Recognizes human PRSS21.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 314

• Applicable Applications for anti-PRSS21 antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa121-221 from human PRSS21 (NP_006790) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGD
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of PRSS21 transfected lysate using PRSS21 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PRSS21 rabbit polyclonal antibody.)

Related Product Information for anti-PRSS21 antibody

This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Alternative splicing of this gene results in three transcript variants encoding three different isoforms. [provided by RefSeq].

Product Categories/Family for anti-PRSS21 antibody

Antibodies; Enzymes; Protease (Proteinase; Peptidase)

NCBI and Uniprot Product Information

• NCBI GI #: 5803197
• NCBI GeneID: 10942
• NCBI Accession #: NP_006790
• NCBI GenBank Nucleotide #: NM_006799
• UniProt Accession #: Q9Y6M0
• NCBI Official Full Name: testisin isoform 1 preproprotein
• NCBI Official Synonym Full Names: serine protease 21
• NCBI Official Symbol: PRSS21
• NCBI Official Synonym Symbols: ESP1; ESP-1; TEST1; TESTISIN
• NCBI Protein Information: testisin
• UniProt Protein Name: Testisin
• Protein Family: Testisin
• UniProt Gene Name: PRSS21
• UniProt Synonym Gene Names: ESP1; TEST1; ESP-1
• UniProt Entry Name: TEST_HUMAN

NCBI Description

This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. The encoded protein is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The encoded protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and may be involved in progression of testicular tumors of germ cell origin. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]