Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.44kD).)

Mouse anti-Human PRRX2 Monoclonal Antibody | anti-PRRX2 antibody

PRRX2 (Paired Mesoderm Homeobox Protein 2, Paired-related Homeobox Protein 2, PMX2, PRX2, PRX-2)

Gene Names
PRRX2; PMX2; PRX2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PRRX2; Monoclonal Antibody; PRRX2 (Paired Mesoderm Homeobox Protein 2; Paired-related Homeobox Protein 2; PMX2; PRX2; PRX-2); Anti -PRRX2 (Paired Mesoderm Homeobox Protein 2; anti-PRRX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4C9
Specificity
Recognizes human PRRX2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
WFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN
Applicable Applications for anti-PRRX2 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa151-254 from human PRRX2 (NP_057391) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.44kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.44kD).)

Western Blot (WB)

(Western Blot analysis of PRRX2 expression in transfected 293T cell line by PRRX2 monoclonal antibody.)

Western Blot (WB) (Western Blot analysis of PRRX2 expression in transfected 293T cell line by PRRX2 monoclonal antibody.)
Product Categories/Family for anti-PRRX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,079 Da
NCBI Official Full Name
paired mesoderm homeobox protein 2
NCBI Official Synonym Full Names
paired related homeobox 2
NCBI Official Symbol
PRRX2
NCBI Official Synonym Symbols
PMX2; PRX2
NCBI Protein Information
paired mesoderm homeobox protein 2; PRX-2; paired-related homeobox protein 2; paired-like homeodomain protein PRX2
UniProt Protein Name
Paired mesoderm homeobox protein 2
UniProt Gene Name
PRRX2
UniProt Synonym Gene Names
PMX2; PRX2; PRX-2
UniProt Entry Name
PRRX2_HUMAN

NCBI Description

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation. [provided by RefSeq, Jul 2008]

Uniprot Description

PRRX2: May play a role in the scarless healing of cutaneous wounds during the first two trimesters of development. Belongs to the paired homeobox family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 9q34.1

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding; transcription factor activity

Biological Process: inner ear morphogenesis; regulation of transcription, DNA-dependent; cartilage development; positive regulation of mesenchymal cell proliferation; positive regulation of smoothened signaling pathway; artery morphogenesis; embryonic cranial skeleton morphogenesis; middle ear morphogenesis; embryonic limb morphogenesis

Research Articles on PRRX2

Similar Products

Product Notes

The PRRX2 prrx2 (Catalog #AAA6008522) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRRX2 (Paired Mesoderm Homeobox Protein 2, Paired-related Homeobox Protein 2, PMX2, PRX2, PRX-2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRRX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the PRRX2 prrx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WFQNRRAKFR RNERAMLASR SASLLKSYSQ EAAIEQPVAP RPTALSPDYL SWTASSPYST VPPYSPGSSG PATPGVNMAN SIASLRLKAK EFSLHHSQVP TVN. It is sometimes possible for the material contained within the vial of "PRRX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.