Mouse anti-Human PRPS2 Monoclonal Antibody | anti-PRPS2 antibody

PRPS2 (Ribose-phosphate Pyrophosphokinase 2, PPRibP, Phosphoribosyl Pyrophosphate Synthase II, PRS-II) (HRP)

Cat. Num. AAA6154377

• Gene Names: PRPS2; PRSII
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRPS2; Monoclonal Antibody; PRPS2 (Ribose-phosphate Pyrophosphokinase 2; PPRibP; Phosphoribosyl Pyrophosphate Synthase II; PRS-II) (HRP); anti-PRPS2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C1
• Specificity: Recognizes human PRPS2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PRPS2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa160-270, from human PRPS2 (NP_002756) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRPS2 expression in transfected 293T cell line by PRPS2 monoclonal antibody. Lane 1: PRPS2 transfected lysate (34.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of PRPS2 over-expressed 293 cell line, cotransfected with PRPS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRPS2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-PRPS2 antibody

PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing results in multiple transcript variants.

Product Categories/Family for anti-PRPS2 antibody

Antibodies; Enzymes; Synthase

NCBI and Uniprot Product Information

• NCBI GI #: 4506129
• NCBI GeneID: 5634
• NCBI Accession #: NP_002756
• NCBI GenBank Nucleotide #: NM_002765
• UniProt Accession #: P11908
• Molecular Weight: 35kDa
• NCBI Official Full Name: ribose-phosphate pyrophosphokinase 2 isoform 2
• NCBI Official Synonym Full Names: phosphoribosyl pyrophosphate synthetase 2
• NCBI Official Symbol: PRPS2
• NCBI Official Synonym Symbols: PRSII
• NCBI Protein Information: ribose-phosphate pyrophosphokinase 2
• UniProt Protein Name: Ribose-phosphate pyrophosphokinase 2
• UniProt Gene Name: PRPS2
• UniProt Synonym Gene Names: PRS-II
• UniProt Entry Name: PRPS2_HUMAN

NCBI Description

This gene encodes a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

PRPS2: Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis. Belongs to the ribose-phosphate pyrophosphokinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - pentose phosphate pathway; EC 2.7.6.1; Kinase, other; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: Xp22.2

Molecular Function: ATP binding; identical protein binding; protein binding; protein homodimerization activity; ribose phosphate diphosphokinase activity

Biological Process: nucleobase, nucleoside, nucleotide and nucleic acid metabolic process