Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PRPS2 expression in transfected 293T cell line by PRPS2 monoclonal antibody. Lane 1: PRPS2 transfected lysate (34.8kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PRPS2 Monoclonal Antibody | anti-PRPS2 antibody

PRPS2 (Ribose-phosphate Pyrophosphokinase 2, PPRibP, Phosphoribosyl Pyrophosphate Synthase II, PRS-II) (HRP)

Gene Names
PRPS2; PRSII
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRPS2; Monoclonal Antibody; PRPS2 (Ribose-phosphate Pyrophosphokinase 2; PPRibP; Phosphoribosyl Pyrophosphate Synthase II; PRS-II) (HRP); anti-PRPS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C1
Specificity
Recognizes human PRPS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PRPS2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa160-270, from human PRPS2 (NP_002756) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAV
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRPS2 expression in transfected 293T cell line by PRPS2 monoclonal antibody. Lane 1: PRPS2 transfected lysate (34.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRPS2 expression in transfected 293T cell line by PRPS2 monoclonal antibody. Lane 1: PRPS2 transfected lysate (34.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of PRPS2 over-expressed 293 cell line, cotransfected with PRPS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRPS2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PRPS2 over-expressed 293 cell line, cotransfected with PRPS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRPS2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-PRPS2 antibody
PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-PRPS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
ribose-phosphate pyrophosphokinase 2 isoform 2
NCBI Official Synonym Full Names
phosphoribosyl pyrophosphate synthetase 2
NCBI Official Symbol
PRPS2
NCBI Official Synonym Symbols
PRSII
NCBI Protein Information
ribose-phosphate pyrophosphokinase 2
UniProt Protein Name
Ribose-phosphate pyrophosphokinase 2
UniProt Gene Name
PRPS2
UniProt Synonym Gene Names
PRS-II
UniProt Entry Name
PRPS2_HUMAN

NCBI Description

This gene encodes a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

PRPS2: Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis. Belongs to the ribose-phosphate pyrophosphokinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - pentose phosphate pathway; EC 2.7.6.1; Kinase, other; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: Xp22.2

Molecular Function: ATP binding; identical protein binding; protein binding; protein homodimerization activity; ribose phosphate diphosphokinase activity

Biological Process: nucleobase, nucleoside, nucleotide and nucleic acid metabolic process

Research Articles on PRPS2

Similar Products

Product Notes

The PRPS2 prps2 (Catalog #AAA6154377) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRPS2 (Ribose-phosphate Pyrophosphokinase 2, PPRibP, Phosphoribosyl Pyrophosphate Synthase II, PRS-II) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRPS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRPS2 prps2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRPS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.