Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PRPH is 1ng/ml using 131884 as a capture antibody.)

Mouse anti-Human PRPH Monoclonal Antibody | anti-PRPH antibody

PRPH (Peripherin, Neurofilament 4, NEF4, PRPH1) APC

Gene Names
PRPH; NEF4; PRPH1
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRPH; Monoclonal Antibody; PRPH (Peripherin; Neurofilament 4; NEF4; PRPH1) APC; anti-PRPH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B3
Specificity
Recognizes human PRPH.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PRPH antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa374-470 of human PRPH with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PRPH is 1ng/ml using 131884 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRPH is 1ng/ml using 131884 as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of PRPH expression in IMR-32 using 131884.)

Western Blot (WB) (Western Blot analysis of PRPH expression in IMR-32 using 131884.)

Immunohistochemistry (IHC)

(Immunoperoxidase of formalin-fixed paraffin-embedded human placenta using 131884 (3ug/ml).)

Immunohistochemistry (IHC) (Immunoperoxidase of formalin-fixed paraffin-embedded human placenta using 131884 (3ug/ml).)

Immunofluorescence (IF)

(Immunofluorescence of on HeLa cell using 131884 (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence of on HeLa cell using 131884 (10ug/ml).)
Product Categories/Family for anti-PRPH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,779 Da
NCBI Official Full Name
peripherin
NCBI Official Synonym Full Names
peripherin
NCBI Official Symbol
PRPH
NCBI Official Synonym Symbols
NEF4; PRPH1
NCBI Protein Information
peripherin; neurofilament 4 (57kD)
UniProt Protein Name
Peripherin
Protein Family
UniProt Gene Name
PRPH
UniProt Synonym Gene Names
NEF4; PRPH1
UniProt Entry Name
PERI_HUMAN

Uniprot Description

peripherin: Class-III neuronal intermediate filament protein. Belongs to the intermediate filament family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 12q12-q13

Cellular Component: membrane; type III intermediate filament; neurofilament; intermediate filament

Molecular Function: structural molecule activity

Biological Process: intermediate filament cytoskeleton organization and biogenesis

Disease: Amyotrophic Lateral Sclerosis 1

Similar Products

Product Notes

The PRPH prph (Catalog #AAA6138466) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRPH (Peripherin, Neurofilament 4, NEF4, PRPH1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRPH can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRPH prph for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRPH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.