Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Mouse PRPF19 Monoclonal Antibody | anti-PRPF19 antibody

PRPF19 (Pre-mRNA-processing Factor 19, PRP19, Nuclear Matrix Protein 200, NMP200, PRP19/PSO4 Homolog, PSO4, hPso4, Senescence Evasion Factor, SNEV, UBOX4) APC

Gene Names
PRPF19; PSO4; SNEV; PRP19; UBOX4; hPSO4; NMP200
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRPF19; Monoclonal Antibody; PRPF19 (Pre-mRNA-processing Factor 19; PRP19; Nuclear Matrix Protein 200; NMP200; PRP19/PSO4 Homolog; PSO4; hPso4; Senescence Evasion Factor; SNEV; UBOX4) APC; anti-PRPF19 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E5
Specificity
Recognizes human PRPF19. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PRPF19 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-91 from human PRPF19 (NP_055317) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB)

(PRPF19 monoclonal antibody. Western Blot analysis of PRPF19 expression in PC-12.)

Western Blot (WB) (PRPF19 monoclonal antibody. Western Blot analysis of PRPF19 expression in PC-12.)

Western Blot (WB)

(PRPF19 monoclonal antibody. Western Blot analysis of PRPF19 expression in Hela NE.)

Western Blot (WB) (PRPF19 monoclonal antibody. Western Blot analysis of PRPF19 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of PRPF19 expression in transfected 293T cell line by PRPF19 monoclonal antibody. Lane 1: PRPF19 transfected lysate (55.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRPF19 expression in transfected 293T cell line by PRPF19 monoclonal antibody. Lane 1: PRPF19 transfected lysate (55.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PRPF19 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRPF19 is 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(PRPF19 monoclonal antibody. Western Blot analysis of PRPF19 expression in NIH/3T3.)

Western Blot (WB) (PRPF19 monoclonal antibody. Western Blot analysis of PRPF19 expression in NIH/3T3.)
Related Product Information for anti-PRPF19 antibody
PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al., 2008 [PubMed 18263876]). [supplied by OMIM].
Product Categories/Family for anti-PRPF19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,181 Da
NCBI Official Full Name
pre-mRNA-processing factor 19
NCBI Official Synonym Full Names
pre-mRNA processing factor 19
NCBI Official Symbol
PRPF19
NCBI Official Synonym Symbols
PSO4; SNEV; PRP19; UBOX4; hPSO4; NMP200
NCBI Protein Information
pre-mRNA-processing factor 19; PRP19/PSO4 homolog; PRP19/PSO4 pre-mRNA processing factor 19 homolog; nuclear matrix protein 200; nuclear matrix protein NMP200 related to splicing factor PRP19; psoralen 4; senescence evasion factor
UniProt Protein Name
Pre-mRNA-processing factor 19
UniProt Gene Name
PRPF19
UniProt Synonym Gene Names
NMP200; PRP19; SNEV; hPso4
UniProt Entry Name
PRP19_HUMAN

Uniprot Description

PRPF19: Plays a role in DNA double-strand break (DSB) repair. Binds double-stranded DNA in a sequence-nonspecific manner. Acts as a structural component of the nuclear framework. May also serve as a support for spliceosome binding and activity. Essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. May have E3 ubiquitin ligase activity. The PSO4 complex is required in the DNA interstrand cross-links (ICLs) repair process. Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. Belongs to the WD repeat PRP19 family.

Protein type: RNA splicing; Ubiquitin conjugating system; Ligase; EC 6.3.2.-; Spliceosome; Ubiquitin ligase; EC 6.3.2.19

Chromosomal Location of Human Ortholog: 11q12.2

Cellular Component: nucleoplasm; DNA replication factor A complex; membrane; cytoplasm; spindle; nuclear speck; lipid particle; nucleus

Molecular Function: identical protein binding; protein binding; ligase activity

Biological Process: positive regulation of nuclear mRNA splicing, via spliceosome; assembly of spliceosomal tri-snRNP; nuclear mRNA splicing, via spliceosome; proteasomal protein catabolic process; negative regulation of neuron differentiation; protein polyubiquitination; RNA splicing; lipid biosynthetic process; spliceosome assembly; gene expression; generation of catalytic spliceosome for first transesterification step; inner cell mass cell proliferation; double-strand break repair via nonhomologous end joining; positive regulation of astrocyte differentiation

Similar Products

Product Notes

The PRPF19 prpf19 (Catalog #AAA6138463) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRPF19 (Pre-mRNA-processing Factor 19, PRP19, Nuclear Matrix Protein 200, NMP200, PRP19/PSO4 Homolog, PSO4, hPso4, Senescence Evasion Factor, SNEV, UBOX4) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRPF19 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRPF19 prpf19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRPF19, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.