Mouse anti-Human PROS1 Monoclonal Antibody | anti-PROS1 antibody

PROS1 (Vitamin K-dependent Protein S, PROS) (Biotin)

Cat. Num. AAA6143760

• Gene Names: PROS1; PSA; PROS; PS21; PS22; PS23; PS24; PS25; THPH5; THPH6
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PROS1; Monoclonal Antibody; PROS1 (Vitamin K-dependent Protein S; PROS) (Biotin); anti-PROS1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3D7
• Specificity: Recognizes human PROS1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PROS1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa419-517, from human PROS1 (NP_000304) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRP
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-PROS1 antibody

Protein S is a vitamin K-dependent plasma protein that functions as a cofactor for the anticoagulant protease, activated protein C (APC) to inhibit blood coagulation. It is found in plasma in both a free, functionally active form and also in an inactive form complexed with C4b-binding protein. Mutations in Protein S result in autosomal dominant hereditary thrombophilia.

Product Categories/Family for anti-PROS1 antibody

Antibodies; Protein S

NCBI and Uniprot Product Information

• NCBI GI #: 192447438
• NCBI GeneID: 5627
• NCBI Accession #: NP_000304
• NCBI GenBank Nucleotide #: NM_000313
• UniProt Accession #: P07225; Q15518; Q7Z715; Q9UCZ8; A8KAC9; D3DN28
• Molecular Weight: 75,123 Da
• NCBI Official Full Name: vitamin K-dependent protein S preproprotein
• NCBI Official Synonym Full Names: protein S (alpha)
• NCBI Official Symbol: PROS1
• NCBI Official Synonym Symbols: PSA; PROS; PS21; PS22; PS23; PS24; PS25; THPH5; THPH6
• NCBI Protein Information: vitamin K-dependent protein S; protein Sa; vitamin K-dependent plasma protein S
• UniProt Protein Name: Vitamin K-dependent protein S
• Protein Family: Proline--tRNA ligase
• UniProt Gene Name: PROS1
• UniProt Synonym Gene Names: PROS
• UniProt Entry Name: PROS_HUMAN

Uniprot Description

PROS1: Anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis. Defects in PROS1 are the cause of thrombophilia due to protein S deficiency, autosomal dominant (THPH5). A hemostatic disorder characterized by impaired regulation of blood coagulation and a tendency to recurrent venous thrombosis. However, many adults with heterozygous disease may be asymptomatic. Based on the plasma levels of total and free PROS1 antigen as well as the serine protease-activated protein C cofactor activity, three types of PROS1D have been described: type I, characterized by reduced total and free PROS1 antigen levels together with reduced anticoagulant activity; type III, in which only free PROS1 antigen and PROS1 activity levels are reduced; and the rare type II which is characterized by normal concentrations of both total and free PROS1 antigen, but low cofactor activity. Defects in PROS1 are the cause of thrombophilia due to protein S deficiency, autosomal recessive (THPH6). A very rare and severe hematologic disorder resulting in thrombosis and secondary hemorrhage usually beginning in early infancy. Some affected individuals develop neonatal purpura fulminans, multifocal thrombosis, or intracranial hemorrhage.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3q11.2

Cellular Component: Golgi membrane; extracellular space; endoplasmic reticulum membrane; Golgi lumen; plasma membrane; extracellular region

Molecular Function: endopeptidase inhibitor activity; calcium ion binding

Biological Process: platelet activation; fibrinolysis; platelet degranulation; cellular protein metabolic process; regulation of complement activation; innate immune response; proteolysis; blood coagulation; post-translational protein modification; leukocyte migration; peptidyl-glutamic acid carboxylation

Disease: Thrombophilia Due To Protein S Deficiency, Autosomal Recessive; Thrombophilia Due To Protein S Deficiency, Autosomal Dominant