Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PRMT5 Monoclonal Antibody | anti-PRMT5 antibody

PRMT5 (Protein Arginine N-methyltransferase 5, 72kD ICln-binding Protein, Histone-arginine N-methyltransferase PRMT5, HRMT1L5, IBP72, Jak-binding Protein 1, JBP1, Shk1 Kinase-binding Protein 1 Homolog, SKB1 Homolog, SKB1Hs, SKB1) (MaxLight 650)

Gene Names
PRMT5; HSL7; JBP1; SKB1; IBP72; SKB1Hs; HRMT1L5
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRMT5; Monoclonal Antibody; PRMT5 (Protein Arginine N-methyltransferase 5; 72kD ICln-binding Protein; Histone-arginine N-methyltransferase PRMT5; HRMT1L5; IBP72; Jak-binding Protein 1; JBP1; Shk1 Kinase-binding Protein 1 Homolog; SKB1 Homolog; SKB1Hs; SKB1) (MaxLight 650); EC=2.1.1.-; EC=2.1.1.125; anti-PRMT5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4F2
Specificity
Recognizes human SKB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
2373
Applicable Applications for anti-PRMT5 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-637 from SKB1 (AAH25979.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PRMT5 antibody
MaxLight650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor647, DyLight649, Cy5 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Product Categories/Family for anti-PRMT5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens protein arginine methyltransferase 5, mRNA
NCBI Official Synonym Full Names
protein arginine methyltransferase 5
NCBI Official Symbol
PRMT5
NCBI Official Synonym Symbols
HSL7; JBP1; SKB1; IBP72; SKB1Hs; HRMT1L5
NCBI Protein Information
protein arginine N-methyltransferase 5

NCBI Description

This gene encodes an enzyme that belongs to the methyltransferase family. The encoded protein catalyzes the transfer of methyl groups to the amino acid arginine, in target proteins that include histones, transcriptional elongation factors and the tumor suppressor p53. This gene plays a role in several cellular processes, including transcriptional regulation, and the assembly of small nuclear ribonucleoproteins. A pseudogene of this gene has been defined on chromosome 4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]

Research Articles on PRMT5

Similar Products

Product Notes

The PRMT5 (Catalog #AAA6224657) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRMT5 (Protein Arginine N-methyltransferase 5, 72kD ICln-binding Protein, Histone-arginine N-methyltransferase PRMT5, HRMT1L5, IBP72, Jak-binding Protein 1, JBP1, Shk1 Kinase-binding Protein 1 Homolog, SKB1 Homolog, SKB1Hs, SKB1) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRMT5 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRMT5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRMT5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.