Mouse anti-Human PRKRIR Monoclonal Antibody | anti-PRKRIR antibody

PRKRIR (52 kDa Repressor of the Inhibitor of the Protein Kinase, p52rIPK, 58 kDa Interferon-induced Protein Kinase-interacting Protein, p58IPK-interacting Protein, Death-associated Protein 4, THAP Domain-containing Protein 0, DAP4, P52RIPK, THAP0, MGC1027

Cat. Num. AAA6003701

• Gene Names: PRKRIR; DAP4; THAP0; THAP12; P52rIPK
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PRKRIR; Monoclonal Antibody; PRKRIR (52 kDa Repressor of the Inhibitor of the Protein Kinase; p52rIPK; 58 kDa Interferon-induced Protein Kinase-interacting Protein; p58IPK-interacting Protein; Death-associated Protein 4; THAP Domain-containing Protein 0; DAP4; P52RIPK; THAP0; MGC1027; Anti -PRKRIR (52 kDa Repressor of the Inhibitor of the Protein Kinase; anti-PRKRIR antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C10-1A6
• Specificity: Recognizes human PRKRIR.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT

• Applicable Applications for anti-PRKRIR antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Full length recombinant corresponding to human PRKRIR, aa1-151 (AAH21992) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-PRKRIR antibody

Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). May block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth.

Product Categories/Family for anti-PRKRIR antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 18314563
• NCBI GeneID: 5612
• UniProt Accession #: O43422; Q17RY9; Q8WTW1; Q9Y3Z4; A8K728
• Molecular Weight: 87,704 Da
• NCBI Official Full Name: PRKRIR protein
• NCBI Official Synonym Full Names: protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor)
• NCBI Official Symbol: PRKRIR
• NCBI Official Synonym Symbols: DAP4; THAP0; THAP12; P52rIPK
• NCBI Protein Information: 52 kDa repressor of the inhibitor of the protein kinase; THAP domain containing 12; death-associated protein 4; p58IPK-interacting protein; inhibitor of protein kinase PKR; THAP domain-containing protein 0; 58 kDa interferon-induced protein kinase-interacting protein
• UniProt Protein Name: 52 kDa repressor of the inhibitor of the protein kinase
• UniProt Gene Name: PRKRIR
• UniProt Synonym Gene Names: DAP4; P52RIPK; THAP0; p52rIPK
• UniProt Entry Name: P52K_HUMAN

Uniprot Description

PRKRIR: Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). May block the PKR- inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 11q13.5

Cellular Component: nucleus

Molecular Function: protein dimerization activity; DNA binding; metal ion binding

Biological Process: negative regulation of cell proliferation; response to stress; signal transduction