Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse PRKRA Monoclonal Antibody | anti-PRKRA antibody

PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator, DYT16, HSD14, PACT, RAX) (MaxLight 490)

Gene Names
PRKRA; RAX; PACT; DYT16; HSD14
Applications
FLISA
Purity
Purified
Synonyms
PRKRA; Monoclonal Antibody; PRKRA (Protein Kinase; Interferon-Inducible Double Stranded RNA Dependent Activator; DYT16; HSD14; PACT; RAX) (MaxLight 490); Protein Kinase; RAX; anti-PRKRA antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G12
Specificity
Recognizes PRKRA.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-PRKRA antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PRKRA (NP_003681, 101aa-200aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENH
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PRKRA antibody
This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants. [provided by RefSeq]
Product Categories/Family for anti-PRKRA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36.8 kDa (336aa) confirmed by MALDI-TOF
NCBI Official Full Name
interferon-inducible double-stranded RNA-dependent protein kinase activator A isoform 1
NCBI Official Synonym Full Names
protein activator of interferon induced protein kinase EIF2AK2
NCBI Official Symbol
PRKRA
NCBI Official Synonym Symbols
RAX; PACT; DYT16; HSD14
NCBI Protein Information
interferon-inducible double-stranded RNA-dependent protein kinase activator A
UniProt Protein Name
Interferon-inducible double-stranded RNA-dependent protein kinase activator A
UniProt Gene Name
PRKRA
UniProt Synonym Gene Names
PACT; RAX
UniProt Entry Name
PRKRA_HUMAN

NCBI Description

This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008]

Uniprot Description

PACT: a double strand RNA binding protein (dsRBP). Interacts with TRBP and Dicer to stimulate the cleavage of double-stranded or short hairpin RNA to siRNA. Appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor. Activates the interferon-induced protein kinase PKR. Three alternatively spliced human isoforms have been reported.

Protein type: Activator; RNA processing; RNA-binding

Chromosomal Location of Human Ortholog: 2q31.2

Cellular Component: cytoplasm; cytosol; membrane; nucleoplasm

Molecular Function: double-stranded RNA binding; enzyme binding; identical protein binding; protein binding; protein homodimerization activity

Biological Process: immune response; miRNA-mediated gene silencing, production of miRNAs; negative regulation of cell proliferation; pre-microRNA processing; response to virus; RNA interference, production of siRNA; RNA-mediated gene silencing

Disease: Dystonia 16

Research Articles on PRKRA

Similar Products

Product Notes

The PRKRA prkra (Catalog #AAA6208073) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PRKRA can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKRA prkra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKRA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.