Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PRKDC monoclonal antibody Western Blot analysis of PRKDC expression in A-431.)

Mouse anti-Human PRKDC Monoclonal Antibody | anti-PRKDC antibody

PRKDC (DNA-dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, HYRC, HYRC1) (FITC)

Gene Names
PRKDC; HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNAPKc; DNA-PKC; DNA-PKcs
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKDC; Monoclonal Antibody; PRKDC (DNA-dependent Protein Kinase Catalytic Subunit; DNA-PK Catalytic Subunit; DNA-PKcs; DNPK1; p460; HYRC; HYRC1) (FITC); anti-PRKDC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Clone Number
1B9
Specificity
Recognizes human PRKDC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
4128
Applicable Applications for anti-PRKDC antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa4019-4129, from human PRKDC (NP_008835) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PRKDC monoclonal antibody Western Blot analysis of PRKDC expression in A-431.)

Western Blot (WB) (PRKDC monoclonal antibody Western Blot analysis of PRKDC expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PRKDC is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRKDC is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-PRKDC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
DNA-dependent protein kinase catalytic subunit isoform 1
NCBI Official Synonym Full Names
protein kinase, DNA-activated, catalytic subunit
NCBI Official Symbol
PRKDC
NCBI Official Synonym Symbols
HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNAPKc; DNA-PKC; DNA-PKcs
NCBI Protein Information
DNA-dependent protein kinase catalytic subunit
UniProt Protein Name
DNA-dependent protein kinase catalytic subunit
UniProt Gene Name
PRKDC
UniProt Synonym Gene Names
HYRC; HYRC1; DNA-PK catalytic subunit; DNA-PKcs
UniProt Entry Name
PRKDC_HUMAN

NCBI Description

This gene encodes the catalytic subunit of the DNA-dependent protein kinase (DNA-PK). It functions with the Ku70/Ku80 heterodimer protein in DNA double strand break repair and recombination. The protein encoded is a member of the PI3/PI4-kinase family.[provided by RefSeq, Jul 2010]

Uniprot Description

DNAPK: an atypical protein kinase of the PIKK family. Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. and modulation of transcription. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Defects cause severe combined immune deficiency (SCID) which is characterized by a lack of mature functional lymphocytes and a high susceptibility to lethal opportunistic infections. Required for repair of radiation-induced dsDNA breaks. Loss of function in mice or horses leads to the SCID (severe combined immune deficiency) phenotype due to failure of immunoglobulin rearrangement. Target of mutation in mismatch repair-deficient colorectal cancer. Inhibitor: KU-7059. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Nucleolus; Protein kinase, atypical; EC 2.7.11.1; DNA repair, damage; Protein kinase, Ser/Thr (non-receptor); ATYPICAL group; PIKK family; DNAPK subfamily

Chromosomal Location of Human Ortholog: 8q11

Cellular Component: nucleoplasm; transcription factor complex; membrane; nucleolus; DNA-dependent protein kinase complex; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; enzyme binding; DNA binding; DNA-dependent protein kinase activity; transcription factor binding; ATP binding; protein kinase activity

Biological Process: positive regulation of apoptosis; heart development; germ cell programmed cell death; T cell differentiation in the thymus; rhythmic process; double-strand break repair via nonhomologous end joining; negative regulation of protein amino acid phosphorylation; double-strand break repair; positive regulation of interferon type I production; response to gamma radiation; telomere maintenance; pro-B cell differentiation; somitogenesis; protein destabilization; immunoglobulin V(D)J recombination; B cell lineage commitment; protein modification process; regulation of circadian rhythm; DNA repair; double-strand break repair via homologous recombination; T cell lineage commitment; peptidyl-serine phosphorylation; DNA damage response, signal transduction resulting in induction of apoptosis; cellular response to insulin stimulus; innate immune response; T cell receptor V(D)J recombination; positive regulation of transcription from RNA polymerase II promoter; brain development

Disease: Immunodeficiency 26 With Or Without Neurologic Abnormalities

Research Articles on PRKDC

Similar Products

Product Notes

The PRKDC prkdc (Catalog #AAA6149047) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRKDC (DNA-dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, HYRC, HYRC1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKDC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKDC prkdc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKDC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.