Mouse anti-Human PRKD3 Monoclonal Antibody | anti-PRKD3 antibody

PRKD3 (Serine/Threonine-protein Kinase D3, Protein Kinase C nu Type, Protein Kinase EPK2, nPKC-nu, EPK2, PRKCN)

Cat. Num. AAA646820

• Gene Names: PRKD3; EPK2; PKD3; PRKCN; PKC-NU; nPKC-NU
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PRKD3; Monoclonal Antibody; PRKD3 (Serine/Threonine-protein Kinase D3; Protein Kinase C nu Type; Protein Kinase EPK2; nPKC-nu; EPK2; PRKCN); Anti -PRKD3 (Serine/Threonine-protein Kinase D3; anti-PRKD3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G7
• Specificity: Recognizes human PRKD3.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPEC

• Applicable Applications for anti-PRKD3 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa1-100 from PRKD3 (AAH30706) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged PRKD3 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-PRKD3 antibody

Protein kinase D (PKD), a serine/threonine kinase originally described as a novel PKC family member and termed PKCm, belongs to the calcium calmodulin superfamily of kinases. Three mammalian isoforms have so far been described - PKD1/PKCm, PKD2 and PKD3/PKCn; these isoforms show a high degree of homology, especially in their catalytic domain. PKDs are major targets for tumor promoting phorbol esters; they are activated via G protein-coupled receptors (GPCRs) and their activation is also dependent on PKC activation. PKDs have been implicated in numerous cellular functions, including signal transduction as well as cell survival, migration, differenciation, and proliferation. They are important regulators of secretary transport at the trans- golgi network. Of the three isoforms, PKD1 is the best characterized. It is involved in the regulation of Golgi function, cell proliferation and apoptosis and it mediates oxidative stress signaling regulating cellular detoxification and survival. PKD2 has been found to phosphorylate histone H1 more efficiently than aldolase in vitro. PKD3 plays a role in the formation of vesicular transport carriers at the trans-Golgi network (TGN) and in basal glucose transport in vitro studies.

Product Categories/Family for anti-PRKD3 antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 22658307
• NCBI GeneID: 23683
• UniProt Accession #: O94806; Q53TR7; Q8NEL8; D6W587
• Molecular Weight: 100,471 Da
• NCBI Official Full Name: PRKD3 protein
• NCBI Official Synonym Full Names: protein kinase D3
• NCBI Official Symbol: PRKD3
• NCBI Official Synonym Symbols: EPK2; PKD3; PRKCN; PKC-NU; nPKC-NU
• NCBI Protein Information: serine/threonine-protein kinase D3; protein kinase EPK2; protein kinase C, nu; protein kinase C nu type; protein-serine/threonine kinase
• UniProt Protein Name: Serine/threonine-protein kinase D3
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: PRKD3
• UniProt Synonym Gene Names: EPK2; PRKCN
• UniProt Entry Name: KPCD3_HUMAN

NCBI Description

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role. The protein encoded by this gene is one of the PKC family members. This kinase can be activated rapidly by the agonists of G protein-coupled receptors. It resides in both cytoplasm and nucleus, and its nuclear accumulation is found to be dramatically enhanced in response to its activation. This kinase can also be activated after B-cell antigen receptor (BCR) engagement, which requires intact phopholipase C gamma and the involvement of other PKC family members. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Converts transient diacylglycerol (DAG) signals into prolonged physiological effects, downstream of PKC. Involved in resistance to oxidative stress

By similarity.

Catalytic activity: ATP + a protein = ADP + a phosphoprotein.

Cofactor: Magnesium

By similarity.

Enzyme regulation: Activated by DAG and phorbol esters. Phorbol-ester/DAG-type domains 1 and 2 bind both DAG and phorbol ester with high affinity and mediate translocation to the cell membrane. Autophosphorylation of Ser-735 and phosphorylation of Ser-731 by PKC relieves auto-inhibition by the PH domain. Ref.7

Subcellular location: Cytoplasm. Membrane. Note: Translocation to the cell membrane is required for kinase activation. Ref.7

Tissue specificity: Ubiquitous.

Sequence similarities: Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PKD subfamily.Contains 1 PH domain.Contains 2 phorbol-ester/DAG-type zinc fingers.Contains 1 protein kinase domain.