Mouse anti-Human PRKD3 Monoclonal Antibody | anti-PRKD3 antibody

PRKD3 (Serine/Threonine-protein Kinase D3, Protein Kinase C nu Type, Protein Kinase EPK2, nPKC-nu, EPK2, PRKCN) (PE)

Cat. Num. AAA6159652

• Gene Names: PRKD3; EPK2; PKD3; PRKCN; PKC-NU; nPKC-NU
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRKD3; Monoclonal Antibody; PRKD3 (Serine/Threonine-protein Kinase D3; Protein Kinase C nu Type; Protein Kinase EPK2; nPKC-nu; EPK2; PRKCN) (PE); anti-PRKD3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G7
• Specificity: Recognizes human PRKD3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-PRKD3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from PRKD3 (AAH30706) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPEC
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged PRKD3 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-PRKD3 antibody

Protein kinase D (PKD), a serine/threonine kinase originally described as a novel PKC family member and termed PKCm, belongs to the calcium calmodulin superfamily of kinases. Three mammalian isoforms have so far been described - PKD1/PKCm, PKD2 and PKD3/PKCn; these isoforms show a high degree of homology, especially in their catalytic domain. PKDs are major targets for tumor promoting phorbol esters; they are activated via G protein-coupled receptors (GPCRs) and their activation is also dependent on PKC activation. PKDs have been implicated in numerous cellular functions, including signal transduction as well as cell survival, migration, differenciation, and proliferation. They are important regulators of secretary transport at the trans- golgi network. Of the three isoforms, PKD1 is the best characterized. It is involved in the regulation of Golgi function, cell proliferation and apoptosis and it mediates oxidative stress signaling regulating cellular detoxification and survival. PKD2 has been found to phosphorylate histone H1 more efficiently than aldolase in vitro. PKD3 plays a role in the formation of vesicular transport carriers at the trans-Golgi network (TGN) and in basal glucose transport in vitro studies.

Product Categories/Family for anti-PRKD3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 34783221
• NCBI GeneID: 23683
• Molecular Weight: 68,123 Da
• NCBI Official Full Name: Homo sapiens protein kinase D3, mRNA
• NCBI Official Synonym Full Names: protein kinase D3
• NCBI Official Symbol: PRKD3
• NCBI Official Synonym Symbols: EPK2; PKD3; PRKCN; PKC-NU; nPKC-NU
• NCBI Protein Information: serine/threonine-protein kinase D3
• Protein Family: Serine/threonine-protein kinase

NCBI Description

This gene belongs to the multigene protein kinase D family of serine/threonine kinases, which bind diacylglycerol and phorbol esters. Members of this family are characterized by an N-terminal regulatory domain comprised of a tandem repeat of cysteine-rich zinc-finger motifs and a pleckstrin domain. The C-terminal region contains the catalytic domain and is distantly related to calcium-regulated kinases. Catalytic activity of this enzyme promotes its nuclear localization. This protein has been implicated in a variety of functions including negative regulation of human airway epithelial barrier formation, growth regulation of breast and prostate cancer cells, and vesicle trafficking. [provided by RefSeq, Jan 2015]