Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PRKCZ expression in transfected 293T cell line by PRKCZ monoclonal antibody. Lane 1: PRKCZ transfected lysate (67.7kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PRKCZ Monoclonal Antibody | anti-PRKCZ antibody

PRKCZ (Protein Kinase C zeta Type, nPKC-zeta, PKC2) (Biotin)

Gene Names
PRKCZ; PKC2; PKC-ZETA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKCZ; Monoclonal Antibody; PRKCZ (Protein Kinase C zeta Type; nPKC-zeta; PKC2) (Biotin); anti-PRKCZ antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D1
Specificity
Recognizes human PRKCZ.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PRKCZ antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa165-255, from human PRKCZ (AAH08058) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRKCZ expression in transfected 293T cell line by PRKCZ monoclonal antibody. Lane 1: PRKCZ transfected lysate (67.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRKCZ expression in transfected 293T cell line by PRKCZ monoclonal antibody. Lane 1: PRKCZ transfected lysate (67.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PRKCZ is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRKCZ is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of PRKCZ over-expressed 293 cell line, cotransfected with PRKCZ Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRKCZ monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PRKCZ over-expressed 293 cell line, cotransfected with PRKCZ Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRKCZ monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-PRKCZ antibody
Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a constitutive kinase activity which is independent of calcium, and PKC activators, phosphatidylserine and diacylglycerol. Furthermore, it is insensitive to PKC inhibitors and cannot be activated by phorbol ester. The structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC.
Product Categories/Family for anti-PRKCZ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
56,136 Da
NCBI Official Full Name
Homo sapiens protein kinase C, zeta, mRNA
NCBI Official Synonym Full Names
protein kinase C zeta
NCBI Official Symbol
PRKCZ
NCBI Official Synonym Symbols
PKC2; PKC-ZETA
NCBI Protein Information
protein kinase C zeta type
Protein Family

NCBI Description

Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Research Articles on PRKCZ

Similar Products

Product Notes

The PRKCZ (Catalog #AAA6143742) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRKCZ (Protein Kinase C zeta Type, nPKC-zeta, PKC2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKCZ can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKCZ for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKCZ, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.