Mouse PRKCI Monoclonal Antibody | anti-PRKCI antibody

PRKCI (Protein Kinase C, iota, DXS1179E, MGC26534, PKCI, nPKC-iota) (AP)

Cat. Num. AAA6162343

• Gene Names: PRKCI; PKCI; DXS1179E; nPKC-iota
• Applications: Western Blot
• Purity: Purified
• Synonyms: PRKCI; Monoclonal Antibody; PRKCI (Protein Kinase C; iota; DXS1179E; MGC26534; PKCI; nPKC-iota) (AP); Protein Kinase C; nPKC-iota; anti-PRKCI antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A10
• Specificity: Recognizes PRKCI.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 587

• Applicable Applications for anti-PRKCI antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PRKCI (AAH22016, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCV
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PRKCI monoclonal antibody (M03), clone 1A10 Western Blot analysis of PRKCI expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged PRKCI is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-PRKCI antibody

This gene encodes a member of the protein kinase C (PKC) family of serine/threonine protein kinases. The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. There is a single exon pseudogene mapped on chromosome X. [provided by RefSeq]

Product Categories/Family for anti-PRKCI antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 127802765
• NCBI GeneID: 5584
• NCBI Official Full Name: Protein kinase C, iota
• NCBI Official Synonym Full Names: protein kinase C iota
• NCBI Official Symbol: PRKCI
• NCBI Official Synonym Symbols: PKCI; DXS1179E; nPKC-iota
• NCBI Protein Information: protein kinase C iota type
• Protein Family: Protein kinase

NCBI Description

This gene encodes a member of the protein kinase C (PKC) family of serine/threonine protein kinases. The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. There is a single exon pseudogene mapped on chromosome X. [provided by RefSeq, Jul 2008]