Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SLIT3 is approximately 3ng/ml as a capture antibody.)

Mouse SLIT3 Monoclonal Antibody | anti-SLIT3 antibody

SLIT3 (slit Homolog 3 (Drosophila), FLJ10764, MEGF5, SLIL2, SLIT1, Slit-3, slit2) (FITC)

Gene Names
SLIT3; MEGF5; SLIL2; SLIT1; slit2; Slit-3
Applications
ELISA
Purity
Purified
Synonyms
SLIT3; Monoclonal Antibody; SLIT3 (slit Homolog 3 (Drosophila); FLJ10764; MEGF5; SLIL2; SLIT1; Slit-3; slit2) (FITC); slit Homolog 3 (Drosophila); slit2; anti-SLIT3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D11
Specificity
Recognizes SLIT3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SLIT3 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SLIT3 (NP_003053, 1371aa-1470aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLIT3 is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLIT3 is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-SLIT3 antibody
Mouse monoclonal antibody raised against a partial recombinant SLIT3.
Product Categories/Family for anti-SLIT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
168kDa
NCBI Official Full Name
slit homolog 3 protein isoform 2
NCBI Official Synonym Full Names
slit guidance ligand 3
NCBI Official Symbol
SLIT3
NCBI Official Synonym Symbols
MEGF5; SLIL2; SLIT1; slit2; Slit-3
NCBI Protein Information
slit homolog 3 protein
UniProt Protein Name
Slit homolog 3 protein
Protein Family
UniProt Gene Name
SLIT3
UniProt Synonym Gene Names
KIAA0814; MEGF5; SLIL2; Slit-3
UniProt Entry Name
SLIT3_HUMAN

NCBI Description

The protein encoded by this gene is secreted, likely interacting with roundabout homolog receptors to effect cell migration. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]

Uniprot Description

SLIT3: May act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: extracellular space; mitochondrion

Molecular Function: Roundabout binding; calcium ion binding

Biological Process: axon extension involved in axon guidance; chemorepulsion involved in embryonic olfactory bulb interneuron migration; axon guidance; negative regulation of cell proliferation; organ morphogenesis; response to cortisol stimulus; negative chemotaxis; negative regulation of cell growth; cellular response to hormone stimulus

Research Articles on SLIT3

Similar Products

Product Notes

The SLIT3 slit3 (Catalog #AAA6177032) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLIT3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLIT3 slit3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLIT3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.