Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PRKCD is 0.1 ng/ml as a capture antibody.)

Mouse PRKCD Monoclonal Antibody | anti-PRKCD antibody

PRKCD (Protein Kinase C, delta, MAY1, MGC49908, PKCD, nPKC-delta) (Biotin)

Gene Names
PRKCD; MAY1; PKCD; ALPS3; CVID9; nPKC-delta
Applications
Western Blot
Purity
Purified
Synonyms
PRKCD; Monoclonal Antibody; PRKCD (Protein Kinase C; delta; MAY1; MGC49908; PKCD; nPKC-delta) (Biotin); Protein Kinase C; nPKC-delta; anti-PRKCD antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F3
Specificity
Recognizes PRKCD.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
676
Applicable Applications for anti-PRKCD antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PRKCD (NP_006245, 577aa-676aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PRKCD is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRKCD is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-PRKCD antibody
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]
Product Categories/Family for anti-PRKCD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein kinase C delta type isoform c
NCBI Official Synonym Full Names
protein kinase C delta
NCBI Official Symbol
PRKCD
NCBI Official Synonym Symbols
MAY1; PKCD; ALPS3; CVID9; nPKC-delta
NCBI Protein Information
protein kinase C delta type
UniProt Protein Name
Protein kinase C delta type
Protein Family
UniProt Gene Name
PRKCD
UniProt Synonym Gene Names
SDK1
UniProt Entry Name
KPCD_HUMAN

NCBI Description

The protein encoded by this gene is a member of the protein kinase C family of serine- and threonine-specific protein kinases. The encoded protein is activated by diacylglycerol and is both a tumor suppressor and a positive regulator of cell cycle progression. Also, this protein can positively or negatively regulate apoptosis. Defects in this gene are a cause of autoimmune lymphoproliferative syndrome. [provided by RefSeq, Aug 2017]

Uniprot Description

PKCD: an AGC kinase of the PKC family. A novel PKC: Ca2 independent but still regulated by PS, DAG and phorbol esters. Caspase-3 appears to liberate a sphingosine-activated catalytic fragment that has altered regulatory mechanisms and substrate specificities.

Protein type: EC 2.7.11.13; Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor); Nuclear receptor co-regulator; Tumor suppressor; Kinase, protein; AGC group; PKC family; Delta subfamily

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: nucleoplasm; nuclear matrix; mitochondrion; endoplasmic reticulum; perinuclear region of cytoplasm; cytoplasm; plasma membrane; intercellular junction; nucleus; cytosol

Molecular Function: calcium-independent protein kinase C activity; protein serine/threonine kinase activity; protein binding; enzyme binding; protein kinase C activity; insulin receptor substrate binding; metal ion binding; enzyme activator activity; non-membrane spanning protein tyrosine kinase activity; ATP binding

Biological Process: B cell proliferation; negative regulation of MAP kinase activity; peptidyl-tyrosine phosphorylation; interleukin-12 production; nerve growth factor receptor signaling pathway; apoptosis; negative regulation of insulin receptor signaling pathway; signal transduction; protein amino acid phosphorylation; positive regulation of protein amino acid dephosphorylation; negative regulation of filopodium formation; positive regulation of superoxide release; regulation of receptor activity; negative regulation of protein binding; cell structure disassembly during apoptosis; epidermal growth factor receptor signaling pathway; platelet activation; negative regulation of peptidyl-tyrosine phosphorylation; fibroblast growth factor receptor signaling pathway; neutrophil activation; protein stabilization; negative regulation of actin filament polymerization; cytokine and chemokine mediated signaling pathway; peptidyl-threonine phosphorylation; cell cycle; phospholipase C activation; negative regulation of inflammatory response; defense response to bacterium; interleukin-10 production; innate immune response; gene expression; immunoglobulin mediated immune response; vascular endothelial growth factor receptor signaling pathway; blood coagulation; induction of apoptosis by oxidative stress

Disease: Autoimmune Lymphoproliferative Syndrome, Type Iii

Research Articles on PRKCD

Similar Products

Product Notes

The PRKCD prkcd (Catalog #AAA6174008) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PRKCD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKCD prkcd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKCD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.