Mouse anti-Human PRKAR2A Monoclonal Antibody | anti-PRKAR2A antibody

PRKAR2A (cAMP-dependent Protein Kinase Type II-alpha Regulatory Subunit, PKR2, PRKAR2, MGC3606) (FITC)

Cat. Num. AAA6149040

• Gene Names: PRKAR2A; PKR2; PRKAR2
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRKAR2A; Monoclonal Antibody; PRKAR2A (cAMP-dependent Protein Kinase Type II-alpha Regulatory Subunit; PKR2; PRKAR2; MGC3606) (FITC); anti-PRKAR2A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6A9
• Specificity: Recognizes human PRKAR2A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PRKAR2A antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-105 from human PRKAR2A (AAH02763) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETY
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRKAR2A expression in HeLa cells using Cat. # 131799.)

Immunohistochemistry (IHC)

(Immunoperoxidase staining of PRKAR2A on formalin-fixed paraffin-embedded human salivary gland using Cat. # 131799 at 3ug/ml.)

Immunofluorescence (IF)

(Immunofluorescence assay of PRKAR2A on HeLa cells using Cat. # 131799 at 10ug/ml.)

Testing Data

(Detection limit for recombinant GST tagged PRKAR2A is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-PRKAR2A antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 33877144
• NCBI GeneID: 5576
• Molecular Weight: 43,067 Da
• NCBI Official Full Name: Homo sapiens protein kinase, cAMP-dependent, regulatory, type II, alpha, mRNA
• NCBI Official Synonym Full Names: protein kinase cAMP-dependent type II regulatory subunit alpha
• NCBI Official Symbol: PRKAR2A
• NCBI Official Synonym Symbols: PKR2; PRKAR2
• NCBI Protein Information: cAMP-dependent protein kinase type II-alpha regulatory subunit
• Protein Family: cAMP-dependent protein kinase

NCBI Description

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. It may interact with various A-kinase anchoring proteins and determine the subcellular localization of cAMP-dependent protein kinase. This subunit has been shown to regulate protein transport from endosomes to the Golgi apparatus and further to the endoplasmic reticulum (ER). [provided by RefSeq, Jul 2008]