Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human PRKAA1 Monoclonal Antibody | anti-PRKAA1 antibody

PRKAA1 (AMPK1, 5'-AMP-activated Protein Kinase Catalytic Subunit alpha-1, Acetyl-CoA Carboxylase Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase, Tau-protein Kinase PRKAA1, MGC33776, MGC57364) APC

Gene Names
PRKAA1; AMPK; AMPKa1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKAA1; Monoclonal Antibody; PRKAA1 (AMPK1; 5'-AMP-activated Protein Kinase Catalytic Subunit alpha-1; Acetyl-CoA Carboxylase Kinase; Hydroxymethylglutaryl-CoA Reductase Kinase; Tau-protein Kinase PRKAA1; MGC33776; MGC57364) APC; anti-PRKAA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D9
Specificity
Recognizes human PRKAA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
207
Applicable Applications for anti-PRKAA1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa451-550 from human PRKAA1 (AAH12622) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(PRKAA1 monoclonal antibody Western Blot analysis of PRKAA1 expression in K-562.)

Western Blot (WB) (PRKAA1 monoclonal antibody Western Blot analysis of PRKAA1 expression in K-562.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PRKAA1 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PRKAA1 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PRKAA1 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRKAA1 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-PRKAA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
PRKAA1 protein
NCBI Official Synonym Full Names
protein kinase AMP-activated catalytic subunit alpha 1
NCBI Official Symbol
PRKAA1
NCBI Official Synonym Symbols
AMPK; AMPKa1
NCBI Protein Information
5'-AMP-activated protein kinase catalytic subunit alpha-1

NCBI Description

The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Research Articles on PRKAA1

Similar Products

Product Notes

The PRKAA1 (Catalog #AAA6138426) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRKAA1 (AMPK1, 5'-AMP-activated Protein Kinase Catalytic Subunit alpha-1, Acetyl-CoA Carboxylase Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase, Tau-protein Kinase PRKAA1, MGC33776, MGC57364) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKAA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKAA1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKAA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.