Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human PPP1R9A Monoclonal Antibody | anti-PPP1R9A antibody

PPP1R9A (Neurabin-1, Neurabin-I, Neural Tissue-specific F-actin-binding Protein I, Protein Phosphatase 1 Regulatory Subunit 9A, KIAA1222, FLJ20068)

Gene Names
PPP1R9A; NRB1; NRBI; Neurabin-I
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PPP1R9A; Monoclonal Antibody; PPP1R9A (Neurabin-1; Neurabin-I; Neural Tissue-specific F-actin-binding Protein I; Protein Phosphatase 1 Regulatory Subunit 9A; KIAA1222; FLJ20068); Anti -PPP1R9A (Neurabin-1; anti-PPP1R9A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6A10
Specificity
Recognizes human PPP1R9A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
PCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMI
Applicable Applications for anti-PPP1R9A antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1090-1189 from human PPP1R9A (XP_371933) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)
Related Product Information for anti-PPP1R9A antibody
Binds to actin filaments (F-actin) and shows cross-linking activity. Binds along the sides of the F-actin. May be involved in neurite formation. Inhibits protein phosphatase 1-alpha activity.
Product Categories/Family for anti-PPP1R9A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
123,342 Da
NCBI Official Full Name
PPP1R9A protein
NCBI Official Synonym Full Names
protein phosphatase 1, regulatory subunit 9A
NCBI Official Symbol
PPP1R9A
NCBI Official Synonym Symbols
NRB1; NRBI; Neurabin-I
NCBI Protein Information
neurabin-1; neural tissue-specific F-actin-binding protein I; protein phosphatase 1, regulatory (inhibitor) subunit 9A
UniProt Protein Name
Neurabin-1
Protein Family
UniProt Gene Name
PPP1R9A
UniProt Synonym Gene Names
KIAA1222
UniProt Entry Name
NEB1_HUMAN

NCBI Description

This gene is imprinted, and located in a cluster of imprinted genes on chromosome 7q12. This gene is transcribed in both neuronal and multiple embryonic tissues, and it is maternally expressed mainly in embryonic skeletal muscle tissues and biallelically expressed in other embryonic tissues. The protein encoded by this gene includes a PDZ domain and a sterile alpha motif (SAM). It is a regulatory subunit of protein phosphatase I, and controls actin cytoskeleton reorganization. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]

Uniprot Description

neurabin 1: Binds to actin filaments (F-actin) and shows cross- linking activity. Binds along the sides of the F-actin. May be involved in neurite formation. Inhibits protein phosphatase 1- alpha activity. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein phosphatase, regulatory subunit; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7q21.3

Cellular Component: cortical actin cytoskeleton; growth cone; dendritic spine; synapse; cell junction; filopodium

Molecular Function: actin filament binding; protein binding

Biological Process: calcium-mediated signaling; actin filament organization; neurite development

Research Articles on PPP1R9A

Similar Products

Product Notes

The PPP1R9A ppp1r9a (Catalog #AAA6008590) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPP1R9A (Neurabin-1, Neurabin-I, Neural Tissue-specific F-actin-binding Protein I, Protein Phosphatase 1 Regulatory Subunit 9A, KIAA1222, FLJ20068) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R9A can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the PPP1R9A ppp1r9a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PCSTAQTSTR SPCMPFSWFN DSRKGSYSFR NLPAPTSSLQ PSPETLISDK KGSKNFTFND DFSPSSTSSA DLSGLGAEPK TPGLSQSLAL SSDESLDMI. It is sometimes possible for the material contained within the vial of "PPP1R9A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.