Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human PPP1R2 Monoclonal Antibody | anti-PPP1R2 antibody

PPP1R2 (Protein Phosphatase Inhibitor 2, IPP-2, IPP2, MGC87148) APC

Gene Names
PPP1R2; IPP2; IPP-2; PPP1R2A
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPP1R2; Monoclonal Antibody; PPP1R2 (Protein Phosphatase Inhibitor 2; IPP-2; IPP2; MGC87148) APC; anti-PPP1R2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E9
Specificity
Recognizes human PPP1R2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PPP1R2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human PPP1R2 (NP_006232) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PPP1R2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PPP1R2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PPP1R2 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPP1R2 is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-PPP1R2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa (189aa), confirmed by MALDI-TOF
NCBI Official Full Name
protein phosphatase inhibitor 2 isoform 2
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory inhibitor subunit 2
NCBI Official Symbol
PPP1R2
NCBI Official Synonym Symbols
IPP2; IPP-2; PPP1R2A
NCBI Protein Information
protein phosphatase inhibitor 2
UniProt Protein Name
Protein phosphatase inhibitor 2
UniProt Gene Name
PPP1R2
UniProt Synonym Gene Names
IPP2; IPP-2
UniProt Entry Name
IPP2_HUMAN

NCBI Description

Protein phosphatase-1 (PP1) is one of the main eukaryotic serine/threonine phosphatases. The protein encoded by this gene binds to the catalytic subunit of PP1, strongly inhibiting its activity. Ten related pseudogenes have been found throughout the human genome. Several splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]

Uniprot Description

PPP1R2: a member of the protein phosphatase inhibitor 1 family. A dopamine- and cyclic AMP-regulated neuronal phosphoprotein. Both dopaminergic and glutamatergic (NMDA) receptor stimulation regulate the extent of DARPP32 phosphorylation, but in opposite directions. Dopamine D1 receptor stimulation enhances cAMP formation, resulting in the phosphorylation of DARPP32; phosphorylated DARPP32 is a potent protein phosphatase-1 inhibitor. NMDA receptor stimulation elevates intracellular calcium, which leads to activation of calcineurin and dephosphorylation of phospho-DARPP32, thereby reducing the phosphatase-1 inhibitory activity of DARPP32. Two alternatively-spliced isoforms have been described.

Protein type: Inhibitor; Protein phosphatase, regulatory subunit; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3q29

Molecular Function: protein binding; type 1 serine/threonine specific protein phosphatase inhibitor activity

Biological Process: glycogen metabolic process; generation of precursor metabolites and energy; negative regulation of catalytic activity; regulation of signal transduction; regulation of phosphoprotein phosphatase activity

Research Articles on PPP1R2

Similar Products

Product Notes

The PPP1R2 ppp1r2 (Catalog #AAA6138400) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPP1R2 (Protein Phosphatase Inhibitor 2, IPP-2, IPP2, MGC87148) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP1R2 ppp1r2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP1R2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.