Mouse anti-Human PPARGC1A Monoclonal Antibody | anti-PPARGC1A antibody

PPARGC1A (Peroxisome Proliferator-activated Receptor gamma Coactivator 1-alpha, PGC-1-alpha, PPAR-gamma Coactivator 1-alpha, PPARGC-1-alpha, Ligand Effect Modulator 6, LEM6, PGC1, PGC1A, PPARGC1) (FITC)

Cat. Num. AAA6148987

• Gene Names: PPARGC1A; LEM6; PGC1; PGC1A; PGC-1v; PPARGC1; PGC-1(alpha)
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PPARGC1A; Monoclonal Antibody; PPARGC1A (Peroxisome Proliferator-activated Receptor gamma Coactivator 1-alpha; PGC-1-alpha; PPAR-gamma Coactivator 1-alpha; PPARGC-1-alpha; Ligand Effect Modulator 6; LEM6; PGC1; PGC1A; PPARGC1) (FITC); anti-PPARGC1A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2F9
• Specificity: Recognizes human PPARGC1A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PPARGC1A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa689-798 from human PPARGC1A (NP_037393) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(PPARGC1A monoclonal antibody Western Blot analysis of PPARGC1A expression in U-2 OS.)

Western Blot (WB)

(PPARGC1A monoclonal antibody Western Blot analysis of PPARGC1A expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged PPARGC1A is ~1ng/ml as a capture antibody.)

Related Product Information for anti-PPARGC1A antibody

PGC1 beta (peroxisome proliferator-activated receptor gamma coactivator 1 beta), also known as PPARGC1B, is an 110kD protein that belongs to a family of PPAR coactivators. It coactivates nuclear receptors such as ERRalpha, upregulating expression of proteins that promote mitochondrial fusion and control basal mitochondrial biogenesis. N- and C-terminal alternate sequences, or deletion of aa156-194, produce isoforms of 984, 1017, 1023 (most common) and 1055aa. Human PGC1 beta aa315-420, which is common to all isoforms, shares 79% and 76% aa identity with mouse and rat PGC1 beta, respectively.

Product Categories/Family for anti-PPARGC1A antibody

Antibodies; Obesity Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7019499
• NCBI GeneID: 10891
• NCBI Accession #: NP_037393
• NCBI GenBank Nucleotide #: NM_013261
• UniProt Accession #: Q9UBK2; Q3LIG1; Q4W5M7; Q9UN32; B7Z406; G8DM16; I3RTT5; I3RTT6; I3RTT7; I3RTT8; I3RTT9
• Molecular Weight: Predicted: 88 kDa; ; Observed: 99 kDa
• NCBI Official Full Name: peroxisome proliferator-activated receptor gamma coactivator 1-alpha
• NCBI Official Synonym Full Names: peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
• NCBI Official Symbol: PPARGC1A
• NCBI Official Synonym Symbols: LEM6; PGC1; PGC1A; PGC-1v; PPARGC1; PGC-1(alpha)
• NCBI Protein Information: peroxisome proliferator-activated receptor gamma coactivator 1-alpha; PGC-1-alpha; L-PGC-1alpha; PPARGC-1-alpha; ligand effect modulator-6; PPAR gamma coactivator variant form; peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcrip
• UniProt Protein Name: Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
• Protein Family: Peroxisome proliferator-activated receptor gamma coactivator
• UniProt Gene Name: PPARGC1A
• UniProt Synonym Gene Names: LEM6; PGC1; PGC1A; PPARGC1; PGC-1-alpha; PPAR-gamma coactivator 1-alpha
• UniProt Entry Name: PRGC1_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. [provided by RefSeq, Jul 2008]