Mouse anti-Human PPARD Monoclonal Antibody | anti-PPARD antibody

PPARD (Peroxisome Proliferator-activated Receptor delta, PPAR-delta, NUCI, Nuclear Hormone Receptor 1, NUC1, Nuclear Receptor Subfamily 1 Group C Member 2, Peroxisome Proliferator-activated Receptor beta, NR1C2, PPARB) (PE)

Cat. Num. AAA6159592

• Gene Names: PPARD; FAAR; NUC1; NUCI; NR1C2; NUCII; PPARB
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PPARD; Monoclonal Antibody; PPARD (Peroxisome Proliferator-activated Receptor delta; PPAR-delta; NUCI; Nuclear Hormone Receptor 1; NUC1; Nuclear Receptor Subfamily 1 Group C Member 2; Peroxisome Proliferator-activated Receptor beta; NR1C2; PPARB) (PE); anti-PPARD antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4E3-1B11
• Specificity: Recognizes human PPARD.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-PPARD antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-362 from human PPARD (AAH02715) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGGE
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (65.45kD))

Western Blot (WB)

(PPARD monoclonal antibody. Western Blot analysis of PPARD expression in Jurkat)

Testing Data

(Detection limit for recombinant GST tagged PPARD is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between HDAC2 and PPARD HeLa cells were stained with HDAC2 rabbit purified polyclonal 1:1200 and PPARD mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Related Product Information for anti-PPARD antibody

The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. [provided by RefSeq] This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biological processes, and may be involved in the development of several chronic diseases, including diabetes, obesity, atherosclerosis, and cancer. This protein is a potent inhibitor of ligand-induced transcription activity of PPAR alpha and PPAR gamma. It may function as an integrator of transcription repression and nuclear receptor signaling. The expression of this gene is found to be elevated in colorectal cancer cells. The elevated expression can be repressed by adenomatosis polyposis coli (APC), a tumor suppressor protein related to APC/beta-catenin signaling pathway. Knockout studies in mice suggested the role of this protein in myelination of the corpus callosum, lipid metabolism, and epidermal cell proliferation.

Product Categories/Family for anti-PPARD antibody

Antibodies; Obesity Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33877063
• NCBI GeneID: 5467
• Molecular Weight: 38,855 Da
• NCBI Official Full Name: Homo sapiens peroxisome proliferator-activated receptor delta, mRNA
• NCBI Official Synonym Full Names: peroxisome proliferator-activated receptor delta
• NCBI Official Symbol: PPARD
• NCBI Official Synonym Symbols: FAAR; NUC1; NUCI; NR1C2; NUCII; PPARB
• NCBI Protein Information: peroxisome proliferator-activated receptor delta; PPAR-beta; PPAR-delta; nuclear hormone receptor 1; nuclear receptor subfamily 1 group C member 2; peroxisome proliferator-activated nuclear receptor beta/delta variant 2; peroxisome proliferator-activated
• Protein Family: Peroxisome proliferator-activated receptor

NCBI Description

This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biological processes, and may be involved in the development of several chronic diseases, including diabetes, obesity, atherosclerosis, and cancer. This protein is a potent inhibitor of ligand-induced transcription activity of PPAR alpha and PPAR gamma. It may function as an integrator of transcription repression and nuclear receptor signaling. The expression of this gene is found to be elevated in colorectal cancer cells. The elevated expression can be repressed by adenomatosis polyposis coli (APC), a tumor suppressor protein related to APC/beta-catenin signaling pathway. Knockout studies in mice suggested the role of this protein in myelination of the corpus callosum, lipid metabolism, and epidermal cell proliferation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010]