Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PPARBP is approximately 0.3ng/ml as a capture antibody.)

Mouse PPARBP Monoclonal Antibody | anti-PPARBP antibody

PPARBP (Mediator Complex Subunit 1, CRSP1, CRSP200, DRIP205, DRIP230, MGC71488, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2) (Biotin)

Gene Names
MED1; PBP; CRSP1; RB18A; TRIP2; PPARBP; CRSP200; DRIP205; DRIP230; PPARGBP; TRAP220
Applications
Western Blot
Purity
Purified
Synonyms
PPARBP; Monoclonal Antibody; PPARBP (Mediator Complex Subunit 1; CRSP1; CRSP200; DRIP205; DRIP230; MGC71488; PBP; PPARGBP; RB18A; TRAP220; TRIP2) (Biotin); Mediator Complex Subunit 1; TRIP2; anti-PPARBP antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H6
Specificity
Recognizes PPARBP.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1581
Applicable Applications for anti-PPARBP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PPARBP (NP_004765, 1391aa-1490aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PPARBP is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPARBP is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-PPARBP antibody
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. It also regulates p53-dependent apoptosis and it is essential for adipogenesis. This protein is known to have the ability to self-oligomerize. [provided by RefSeq]
Product Categories/Family for anti-PPARBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 1
NCBI Official Synonym Full Names
mediator complex subunit 1
NCBI Official Symbol
MED1
NCBI Official Synonym Symbols
PBP; CRSP1; RB18A; TRIP2; PPARBP; CRSP200; DRIP205; DRIP230; PPARGBP; TRAP220
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 1
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 1
UniProt Gene Name
MED1
UniProt Synonym Gene Names
ARC205; CRSP1; CRSP200; DRIP205; DRIP230; PBP; PPARBP; PPARGBP; RB18A; TRAP220; TRIP2; ARC205; PBP; PPAR-binding protein; Trap220; TR-interacting protein 2; TRIP-2
UniProt Entry Name
MED1_HUMAN

NCBI Description

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. It also regulates p53-dependent apoptosis and it is essential for adipogenesis. This protein is known to have the ability to self-oligomerize. [provided by RefSeq, Jul 2008]

Uniprot Description

MED1: a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. Also is a component of other multisubunit complexes e.g. thyroid hormone receptor- (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. May regulates p53-dependent apoptosis. Is essential for adipogenesis. This protein is known to have the ability to self-oligomerize. Two splice-variant isoforms have been described.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: nucleoplasm; membrane; nucleolus; Srb-mediator complex; nucleus; chromatin

Molecular Function: ligand-dependent nuclear receptor binding; peroxisome proliferator activated receptor binding; retinoic acid receptor binding; chromatin DNA binding; transcription coactivator activity; receptor activity; transcription factor binding; thyroid hormone receptor coactivator activity; protein binding; ligand-dependent nuclear receptor transcription coactivator activity; vitamin D receptor binding; transcription cofactor activity; LBD domain binding; estrogen receptor binding; chromatin binding; thyroid hormone receptor binding; nuclear hormone receptor binding

Biological Process: fat cell differentiation; lactation; lens development in camera-type eye; embryonic placenta development; erythrocyte development; regulation of cell cycle; positive regulation of transcription, DNA-dependent; positive regulation of estrogen receptor signaling pathway; positive regulation of mammary gland epithelial cell proliferation; cell morphogenesis; enucleate erythrocyte development; negative regulation of transcription from RNA polymerase II promoter; cellular lipid metabolic process; androgen biosynthetic process; embryonic hindlimb morphogenesis; angiogenesis; positive regulation of keratinocyte differentiation; steroid hormone receptor signaling pathway; transcription initiation from RNA polymerase II promoter; regulation of transcription from RNA polymerase I promoter; organ regeneration; positive regulation of protein import into nucleus, translocation; monocyte differentiation; embryonic hemopoiesis; thyroid hormone generation; liver development; mRNA transcription from RNA polymerase II promoter; keratinocyte differentiation; negative regulation of neuron differentiation; androgen receptor signaling pathway; embryonic heart tube development; gene expression; positive regulation of transcription from RNA polymerase II promoter; brain development; negative regulation of apoptosis

Research Articles on PPARBP

Similar Products

Product Notes

The PPARBP med1 (Catalog #AAA6171223) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PPARBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPARBP med1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPARBP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.