Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.11kD).)

Mouse anti-Human POU3F2 Monoclonal Antibody | anti-POU3F2 antibody

POU3F2 (BRN2, OCT7, OTF7, POU Domain, Class 3, Transcription Factor 2, Brain-specific Homeobox/POU Domain Protein 2, Nervous System-specific Octamer-binding Transcription Factor N-Oct-3, Octamer-binding Protein 7, Octamer-binding Transcription Factor 7) (

Gene Names
POU3F2; BRN2; OCT7; OTF7; OTF-7; POUF3; brn-2; oct-7; N-Oct3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POU3F2; Monoclonal Antibody; POU3F2 (BRN2; OCT7; OTF7; POU Domain; Class 3; Transcription Factor 2; Brain-specific Homeobox/POU Domain Protein 2; Nervous System-specific Octamer-binding Transcription Factor N-Oct-3; Octamer-binding Protein 7; Octamer-binding Transcription Factor 7) (; anti-POU3F2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
6F6
Specificity
Recognizes human POU3F2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-POU3F2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-68 from human POU3F2 (NP_005595) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSH
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.11kD).)

Western Blot (WB)

(POU3F2 monoclonal antibody Western Blot analysis of POU3F2 expression in HeLa NE.)

Western Blot (WB) (POU3F2 monoclonal antibody Western Blot analysis of POU3F2 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of POU3F2 expression in transfected 293T cell line by POU3F2 monoclonal antibody. Lane 1: POU3F2 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of POU3F2 expression in transfected 293T cell line by POU3F2 monoclonal antibody. Lane 1: POU3F2 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged POU3F2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged POU3F2 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-POU3F2 antibody
POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, that occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176) and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression (Schreiber et al., 1993 [PubMed 8441633]; Atanasoski et al., 1995 [PubMed 7601453]).
Product Categories/Family for anti-POU3F2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
POU domain, class 3, transcription factor 2
NCBI Official Synonym Full Names
POU class 3 homeobox 2
NCBI Official Symbol
POU3F2
NCBI Official Synonym Symbols
BRN2; OCT7; OTF7; OTF-7; POUF3; brn-2; oct-7; N-Oct3
NCBI Protein Information
POU domain, class 3, transcription factor 2; brain-2; octamer-binding protein 7; octamer-binding transcription factor 7; brain-specific homeobox/POU domain protein 2; nervous system-specific octamer-binding transcription factor N-Oct-3
UniProt Protein Name
POU domain, class 3, transcription factor 2
UniProt Gene Name
POU3F2
UniProt Synonym Gene Names
BRN2; OCT7; OTF7; Brain-2; Brn-2; Oct-7; OTF-7
UniProt Entry Name
PO3F2_HUMAN

NCBI Description

This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells. [provided by RefSeq, Mar 2012]

Uniprot Description

Oct7: Transcription factor that binds preferentially to the recognition sequence which consists of two distinct half-sites, ('GCAT') and ('TAAT'), separated by a nonconserved spacer region of 0, 2, or 3 nucleotides. Positively regulates the genes under the control of corticotropin-releasing hormone (CRH) and CRH II promoters. Interacts with PQBP1. Expressed specifically in the neuroectodermal cell lineage. Belongs to the POU transcription factor family. Class- 3 subfamily. 3 isoforms of the human protein are produced by alternative initiation.

Protein type: Transcription factor; Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 6q16

Cellular Component: transcription factor complex; nucleus

Molecular Function: identical protein binding; protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: epidermis development; transcription, DNA-dependent; positive regulation of multicellular organism growth; hypothalamus cell differentiation; regulation of axonogenesis; astrocyte development; myelination in the peripheral nervous system; neuron differentiation; neurohypophysis development; positive regulation of cell proliferation; cerebral cortex radially oriented cell migration; positive regulation of transcription from RNA polymerase II promoter; forebrain ventricular zone progenitor cell division

Research Articles on POU3F2

Similar Products

Product Notes

The POU3F2 pou3f2 (Catalog #AAA6154281) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POU3F2 (BRN2, OCT7, OTF7, POU Domain, Class 3, Transcription Factor 2, Brain-specific Homeobox/POU Domain Protein 2, Nervous System-specific Octamer-binding Transcription Factor N-Oct-3, Octamer-binding Protein 7, Octamer-binding Transcription Factor 7) ( reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POU3F2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POU3F2 pou3f2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POU3F2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.