Mouse anti-Human POU3F2 Monoclonal Antibody | anti-POU3F2 antibody

POU3F2 (BRN2, OCT7, OTF7, POU Domain, Class 3, Transcription Factor 2, Brain-specific Homeobox/POU Domain Protein 2, Nervous System-specific Octamer-binding Transcription Factor N-Oct-3, Octamer-binding Protein 7, Octamer-binding Transcription Factor 7) (

Cat. Num. AAA6148978

• Gene Names: POU3F2; BRN2; OCT7; OTF7; OTF-7; POUF3; brn-2; oct-7; N-Oct3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: POU3F2; Monoclonal Antibody; POU3F2 (BRN2; OCT7; OTF7; POU Domain; Class 3; Transcription Factor 2; Brain-specific Homeobox/POU Domain Protein 2; Nervous System-specific Octamer-binding Transcription Factor N-Oct-3; Octamer-binding Protein 7; Octamer-binding Transcription Factor 7) (; anti-POU3F2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 6F6
• Specificity: Recognizes human POU3F2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-POU3F2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-68 from human POU3F2 (NP_005595) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSH
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.11kD).)

Western Blot (WB)

(POU3F2 monoclonal antibody Western Blot analysis of POU3F2 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of POU3F2 expression in transfected 293T cell line by POU3F2 monoclonal antibody. Lane 1: POU3F2 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged POU3F2 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-POU3F2 antibody

POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, that occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176) and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression (Schreiber et al., 1993 [PubMed 8441633]; Atanasoski et al., 1995 [PubMed 7601453]).

Product Categories/Family for anti-POU3F2 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 51702521
• NCBI GeneID: 5454
• NCBI Accession #: NP_005595
• NCBI GenBank Nucleotide #: NM_005604
• UniProt Accession #: P20265; Q14960; Q86V54; Q9UJL0
• Molecular Weight: 49 kDa
• NCBI Official Full Name: POU domain, class 3, transcription factor 2
• NCBI Official Synonym Full Names: POU class 3 homeobox 2
• NCBI Official Symbol: POU3F2
• NCBI Official Synonym Symbols: BRN2; OCT7; OTF7; OTF-7; POUF3; brn-2; oct-7; N-Oct3
• NCBI Protein Information: POU domain, class 3, transcription factor 2; brain-2; octamer-binding protein 7; octamer-binding transcription factor 7; brain-specific homeobox/POU domain protein 2; nervous system-specific octamer-binding transcription factor N-Oct-3
• UniProt Protein Name: POU domain, class 3, transcription factor 2
• Protein Family: POU domain, class 3, transcription factor
• UniProt Gene Name: POU3F2
• UniProt Synonym Gene Names: BRN2; OCT7; OTF7; Brain-2; Brn-2; Oct-7; OTF-7
• UniProt Entry Name: PO3F2_HUMAN

NCBI Description

This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells. [provided by RefSeq, Mar 2012]

Uniprot Description

Oct7: Transcription factor that binds preferentially to the recognition sequence which consists of two distinct half-sites, ('GCAT') and ('TAAT'), separated by a nonconserved spacer region of 0, 2, or 3 nucleotides. Positively regulates the genes under the control of corticotropin-releasing hormone (CRH) and CRH II promoters. Interacts with PQBP1. Expressed specifically in the neuroectodermal cell lineage. Belongs to the POU transcription factor family. Class- 3 subfamily. 3 isoforms of the human protein are produced by alternative initiation.

Protein type: Transcription factor; Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 6q16

Cellular Component: transcription factor complex; nucleus

Molecular Function: identical protein binding; protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: epidermis development; transcription, DNA-dependent; positive regulation of multicellular organism growth; hypothalamus cell differentiation; regulation of axonogenesis; astrocyte development; myelination in the peripheral nervous system; neuron differentiation; neurohypophysis development; positive regulation of cell proliferation; cerebral cortex radially oriented cell migration; positive regulation of transcription from RNA polymerase II promoter; forebrain ventricular zone progenitor cell division