Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human POTEH Monoclonal Antibody | anti-POTEH antibody

POTEH (A26C3, ACTBL1, POTE22, POTE Ankyrin Domain Family Member H, ANKRD26-like Family C Member 3, Prostate, Ovary, Testis-expressed Protein on Chromosome 22)

Gene Names
POTEH; A26C3; ACTBL1; POTE22; CT104.7
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
POTEH; Monoclonal Antibody; POTEH (A26C3; ACTBL1; POTE22; POTE Ankyrin Domain Family Member H; ANKRD26-like Family C Member 3; Prostate; Ovary; Testis-expressed Protein on Chromosome 22); Anti -POTEH (A26C3; anti-POTEH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G10
Specificity
Recognizes human POTEH.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
VPRKDLIVMLKDTDMNKKDKQKRTALHLASANGNSEVVKLLLDRRCQLNVLDNKKRTALTKAVQCQEDECALMLLEHGTDPNIPDEYGNTALHYAIYNED*
Applicable Applications for anti-POTEH antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa189-289 from POTEH (NP_001004053) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(POTEH monoclonal antibody. Western Blot analysis of POTEH expression in K-562.)

Western Blot (WB) (POTEH monoclonal antibody. Western Blot analysis of POTEH expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged POTEH is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged POTEH is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-POTEH antibody
POTEH belongs to the POTE family and contains 7 ANK repeats.
Product Categories/Family for anti-POTEH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,965 Da
NCBI Official Full Name
POTE ankyrin domain family member H
NCBI Official Synonym Full Names
POTE ankyrin domain family, member H
NCBI Official Symbol
POTEH
NCBI Official Synonym Symbols
A26C3; ACTBL1; POTE22; CT104.7
NCBI Protein Information
POTE ankyrin domain family member H; POTE-22; actin, beta-like 1; ANKRD26-like family C member 3; ANKRD26-like family C, member 3; cancer/testis antigen family 104, member 7; prostate, ovary, testis-expressed protein on chromosome 22; protein expressed in prostate, ovary, testis, and placenta 22; protein expressed in prostate, ovary, testis, and placenta POTE14 like
UniProt Protein Name
POTE ankyrin domain family member H
UniProt Gene Name
POTEH
UniProt Synonym Gene Names
A26C3; ACTBL1; POTE22; POTE-22
UniProt Entry Name
POTEH_HUMAN

Uniprot Description

ACTBL1: Belongs to the POTE family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis; Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: 22q11.1

Similar Products

Product Notes

The POTEH poteh (Catalog #AAA6010290) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POTEH (A26C3, ACTBL1, POTE22, POTE Ankyrin Domain Family Member H, ANKRD26-like Family C Member 3, Prostate, Ovary, Testis-expressed Protein on Chromosome 22) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POTEH can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the POTEH poteh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VPRKDLIVML KDTDMNKKDK QKRTALHLAS ANGNSEVVKL LLDRRCQLNV LDNKKRTALT KAVQCQEDEC ALMLLEHGTD PNIPDEYGNT ALHYAIYNED *. It is sometimes possible for the material contained within the vial of "POTEH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.