Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.67kD).)

Mouse anti-Human POMC Monoclonal Antibody | anti-POMC antibody

POMC (Pro-opiomelanocortin, NPP, Melanotropin gamma, Gamma-MSH, Potential Peptide, Corticotropin, Adrenocorticotropic Hormone, ACTH, Melanotropin alpha, Alpha-MSH, Corticotropin-like Intermediary Peptide, CLIP, Lipotropin beta, Beta-LPH, Lipotropin gamma,

Gene Names
POMC; LPH; MSH; NPP; POC; ACTH; CLIP
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POMC; Monoclonal Antibody; POMC (Pro-opiomelanocortin; NPP; Melanotropin gamma; Gamma-MSH; Potential Peptide; Corticotropin; Adrenocorticotropic Hormone; ACTH; Melanotropin alpha; Alpha-MSH; Corticotropin-like Intermediary Peptide; CLIP; Lipotropin beta; Beta-LPH; Lipotropin gamma; ; anti-POMC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E11
Specificity
Recognizes human POMC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-POMC antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa205-268 from human POMC (NP_000930) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.67kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.67kD).)

Western Blot (WB)

(Western Blot analysis of POMC expression in transfected 293T cell line by POMC monoclonal antibody. Lane 1: POMC transfected lysate (29.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of POMC expression in transfected 293T cell line by POMC monoclonal antibody. Lane 1: POMC transfected lysate (29.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged POMC is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged POMC is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-POMC antibody
ACTH stimulates the adrenal glands to release cortisol. MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes. Beta-endorphin and Met-enkephalin are endogenous opiates.
Product Categories/Family for anti-POMC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
POMC, partial
NCBI Official Synonym Full Names
proopiomelanocortin
NCBI Official Symbol
POMC
NCBI Official Synonym Symbols
LPH; MSH; NPP; POC; ACTH; CLIP
NCBI Protein Information
pro-opiomelanocortin; adrenocorticotropic hormone; adrenocorticotropin; alpha-MSH; alpha-melanocyte-stimulating hormone; beta-LPH; beta-MSH; beta-endorphin; beta-melanocyte-stimulating hormone; corticotropin-like intermediary peptide; corticotropin-lipotr
UniProt Protein Name
POMC protein
Protein Family
UniProt Gene Name
POMC
UniProt Entry Name
Q6FHC8_HUMAN

NCBI Description

This gene encodes a polypeptide hormone precursor that undergoes extensive, tissue-specific, post-translational processing via cleavage by subtilisin-like enzymes known as prohormone convertases. There are eight potential cleavage sites within the polypeptide precursor and, depending on tissue type and the available convertases, processing may yield as many as ten biologically active peptides involved in diverse cellular functions. The encoded protein is synthesized mainly in corticotroph cells of the anterior pituitary where four cleavage sites are used; adrenocorticotrophin, essential for normal steroidogenesis and the maintenance of normal adrenal weight, and lipotropin beta are the major end products. In other tissues, including the hypothalamus, placenta, and epithelium, all cleavage sites may be used, giving rise to peptides with roles in pain and energy homeostasis, melanocyte stimulation, and immune modulation. These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin and beta-lipotropin peptides. The antimicrobial melanotropin alpha peptide exhibits antibacterial and antifungal activity. Mutations in this gene have been associated with early onset obesity, adrenal insufficiency, and red hair pigmentation. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Nov 2014]

Uniprot Description

POMC: ACTH stimulates the adrenal glands to release cortisol. Defects in POMC may be associated with susceptibility to obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. Defects in POMC are the cause of pro-opiomelanocortinin deficiency (POMCD). Affected individuals present early-onset obesity, adrenal insufficiency and red hair. Belongs to the POMC family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 2p23.3

Cellular Component: peroxisomal matrix; extracellular space; cytoplasm; extracellular region; peroxisome; secretory granule

Molecular Function: type 3 melanocortin receptor binding; G-protein-coupled receptor binding; type 4 melanocortin receptor binding; hormone activity; receptor binding

Biological Process: generation of precursor metabolites and energy; cellular protein metabolic process; cell-cell signaling; neuropeptide signaling pathway; regulation of blood pressure; regulation of appetite; peptide hormone processing; positive regulation of transcription from RNA polymerase II promoter; negative regulation of tumor necrosis factor production; signal transduction; glucose homeostasis; cellular pigmentation

Disease: Obesity; Proopiomelanocortin Deficiency

Research Articles on POMC

Similar Products

Product Notes

The POMC pomc (Catalog #AAA6159573) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POMC (Pro-opiomelanocortin, NPP, Melanotropin gamma, Gamma-MSH, Potential Peptide, Corticotropin, Adrenocorticotropic Hormone, ACTH, Melanotropin alpha, Alpha-MSH, Corticotropin-like Intermediary Peptide, CLIP, Lipotropin beta, Beta-LPH, Lipotropin gamma, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POMC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POMC pomc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POMC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.