Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human POLR1B Monoclonal Antibody | anti-POLR1B antibody

POLR1B (DNA-directed RNA Polymerase I Subunit RPA2, DNA-directed RNA Polymerase I 135kD Polypeptide, FLJ10816, FLJ21921, MGC131780)

Gene Names
POLR1B; RPA2; RPA135; Rpo1-2
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
POLR1B; Monoclonal Antibody; POLR1B (DNA-directed RNA Polymerase I Subunit RPA2; DNA-directed RNA Polymerase I 135kD Polypeptide; FLJ10816; FLJ21921; MGC131780); Anti -POLR1B (DNA-directed RNA Polymerase I Subunit RPA2; anti-POLR1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H6
Specificity
Recognizes human POLR1B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GEMLKAAGYNFYGTERLYSGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHVCVK
Applicable Applications for anti-POLR1B antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa963-1073 from human POLR1B (NP_061887) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to POLR1B on HeLa cell . [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to POLR1B on HeLa cell . [antibody concentration 10ug/ml].)
Related Product Information for anti-POLR1B antibody
Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species. Most of the mass of the pol I complex derives from the 2 largest subunits, Rpa1 and Rpa2 in yeast. POLR1B is homologous to Rpa2 (Seither and Grummt, 1996 [PubMed 8921381]).
Product Categories/Family for anti-POLR1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
128,229 Da
NCBI Official Full Name
POLR1B protein
NCBI Official Synonym Full Names
polymerase (RNA) I polypeptide B, 128kDa
NCBI Official Symbol
POLR1B
NCBI Official Synonym Symbols
RPA2; RPA135; Rpo1-2
NCBI Protein Information
DNA-directed RNA polymerase I subunit RPA2; RNA polymerase I subunit 2; DNA-directed RNA polymerase I 135kDa polypeptide; DNA-directed RNA polymerase I 135 kDa polypeptide
UniProt Protein Name
DNA-directed RNA polymerase I subunit RPA2
UniProt Gene Name
POLR1B
UniProt Synonym Gene Names
RNA polymerase I subunit 2; RPA135
UniProt Entry Name
RPA2_HUMAN

NCBI Description

Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species. Most of the mass of the pol I complex derives from the 2 largest subunits, Rpa1 and Rpa2 in yeast. POLR1B is homologous to Rpa2 (Seither and Grummt, 1996 [PubMed 8921381]).[supplied by OMIM, Mar 2008]

Uniprot Description

POLR1B: a subunit of RNA polymerase I (Pol I), a DNA-dependent RNA polymerase that synthesizes ribosomal RNA precursors. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol I is composed of mobile elements and RPA2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the clef. Two alternatively spliced human isoforms have been described.

Protein type: EC 2.7.7.6; Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine; Transcription initiation complex; Nucleolus; Transferase

Chromosomal Location of Human Ortholog: 2q13

Cellular Component: nucleoplasm; cytoplasm; nucleolus; DNA-directed RNA polymerase I complex

Molecular Function: protein binding; DNA binding; ribonucleoside binding; metal ion binding

Biological Process: negative regulation of gene expression, epigenetic; nucleologenesis; transcription from RNA polymerase I promoter; RNA elongation from RNA polymerase I promoter; gene expression; termination of RNA polymerase I transcription; transcription initiation from RNA polymerase I promoter; regulation of gene expression, epigenetic; embryo implantation; rRNA transcription

Research Articles on POLR1B

Similar Products

Product Notes

The POLR1B polr1b (Catalog #AAA642389) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POLR1B (DNA-directed RNA Polymerase I Subunit RPA2, DNA-directed RNA Polymerase I 135kD Polypeptide, FLJ10816, FLJ21921, MGC131780) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLR1B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the POLR1B polr1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GEMLKAAGYN FYGTERLYSG ISGLELEADI FIGVVYYQRL RHMVSDKFQV RTTGARDRVT NQPIGGRNVQ GGIRFGEMER DALLAHGTSF LLHDRLFNCS DRSVAHVCVK. It is sometimes possible for the material contained within the vial of "POLR1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.