Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human POLI Monoclonal Antibody | anti-POLI antibody

POLI (RAD30B, DNA Polymerase iota, Eta2, RAD30 Homolog B) (FITC)

Gene Names
POLI; RAD30B; RAD3OB
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POLI; Monoclonal Antibody; POLI (RAD30B; DNA Polymerase iota; Eta2; RAD30 Homolog B) (FITC); anti-POLI antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
8G9
Specificity
Recognizes human POLI.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-POLI antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa616-716 from POLI (AAH32662) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKITFPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(POLI monoclonal antibody Western Blot analysis of POLI expression in HeLa NE)

Western Blot (WB) (POLI monoclonal antibody Western Blot analysis of POLI expression in HeLa NE)

Western Blot (WB)

(Western Blot analysis of POLI expression in transfected 293T cell line by POLI monoclonal antibody Lane 1: POLI transfected lysate (80.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of POLI expression in transfected 293T cell line by POLI monoclonal antibody Lane 1: POLI transfected lysate (80.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged POLI is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged POLI is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-POLI antibody
Error-prone DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Favors Hoogsteen base-pairing in the active site. Inserts the correct base with high-fidelity opposite an adenosine template. Exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine. May play a role in hypermutation of immunogobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but may not have lyase activity.
Product Categories/Family for anti-POLI antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
83,006 Da
NCBI Official Full Name
Homo sapiens polymerase (DNA directed) iota, mRNA
NCBI Official Synonym Full Names
polymerase (DNA directed) iota
NCBI Official Symbol
POLI
NCBI Official Synonym Symbols
RAD30B; RAD3OB
NCBI Protein Information
DNA polymerase iota; eta2; RAD30 homolog B; polymerase (DNA-directed), iota
UniProt Protein Name
DNA polymerase iota
Protein Family
UniProt Gene Name
POLI
UniProt Synonym Gene Names
RAD30B
UniProt Entry Name
POLI_HUMAN

Uniprot Description

POLI: Error-prone DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Favors Hoogsteen base-pairing in the active site. Inserts the correct base with high-fidelity opposite an adenosine template. Exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine. May play a role in hypermutation of immunogobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but may not have lyase activity. Belongs to the DNA polymerase type-Y family.

Protein type: EC 2.7.7.7; DNA repair, damage; Transferase

Chromosomal Location of Human Ortholog: 18q21.1

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; intracellular; nucleus

Molecular Function: protein binding; metal ion binding; damaged DNA binding; DNA-directed DNA polymerase activity

Biological Process: DNA repair; DNA replication

Similar Products

Product Notes

The POLI poli (Catalog #AAA6148951) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POLI (RAD30B, DNA Polymerase iota, Eta2, RAD30 Homolog B) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLI can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POLI poli for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POLI, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.