Mouse POLE2 Monoclonal Antibody | anti-POLE2 antibody

POLE2 (DPE2, DNA Polymerase epsilon Subunit 2, DNA Polymerase II Subunit 2, DNA Polymerase epsilon Subunit B) (HRP)

Cat. Num. AAA6154252

• Gene Names: POLE2; DPE2
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: POLE2; Monoclonal Antibody; POLE2 (DPE2; DNA Polymerase epsilon Subunit 2; DNA Polymerase II Subunit 2; DNA Polymerase epsilon Subunit B) (HRP); anti-POLE2 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A3
• Specificity: Recognizes human POLE2. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 527

• Applicable Applications for anti-POLE2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from human POLE2 (NP_002683) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAAVQECSQSVDETIEHVFNIIGAFDIPRFVYN
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(POLE2 monoclonal antibody Western Blot analysis of POLE2 expression in PC-12.)

Western Blot (WB)

(POLE2 monoclonal antibody Western Blot analysis of POLE2 expression in Raw 264.7.)

Western Blot (WB)

(POLE2 monoclonal antibody. Western Blot analysis of POLE2 expression in NIH/3T3.)

Related Product Information for anti-POLE2 antibody

Participates in DNA repair and in chromosomal DNA replication.

Product Categories/Family for anti-POLE2 antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 32189369
• NCBI GeneID: 5427
• NCBI Accession #: NP_002683
• NCBI GenBank Nucleotide #: NM_002692
• UniProt Accession #: P56282
• NCBI Official Full Name: DNA polymerase epsilon subunit 2 isoform 1
• NCBI Official Synonym Full Names: DNA polymerase epsilon 2, accessory subunit
• NCBI Official Symbol: POLE2
• NCBI Official Synonym Symbols: DPE2
• NCBI Protein Information: DNA polymerase epsilon subunit 2
• UniProt Protein Name: DNA polymerase epsilon subunit 2
• Protein Family: DNA polymerase
• UniProt Gene Name: POLE2
• UniProt Synonym Gene Names: DPE2
• UniProt Entry Name: DPOE2_HUMAN

NCBI Description

DNA polymerase epsilon, which is involved in DNA repair and replication, is composed of a large catalytic subunit and a small accessory subunit. The protein encoded by this gene represents the small subunit (B). Defects in this gene have been linked to colorectal cancer and to combined immunodeficiency. [provided by RefSeq, Jan 2017]