Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human PMFBP1 Monoclonal Antibody | anti-PMFBP1 antibody

PMFBP1 (Polyamine-modulated Factor 1-binding Protein 1, PMF-1-binding Protein, DKFZp434G131, FLJ40146)

Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PMFBP1; Monoclonal Antibody; PMFBP1 (Polyamine-modulated Factor 1-binding Protein 1; PMF-1-binding Protein; DKFZp434G131; FLJ40146); Anti -PMFBP1 (Polyamine-modulated Factor 1-binding Protein 1; anti-PMFBP1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4G9
Specificity
Recognizes human PMFBP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
FHTEELQTSYYSLRQYQSILEKQTSDLVLLHHHCKLKEDEVILYEEEMGNHNENTGEKLHLAQEQLALAGDKIASLERSLNLYRDKYQSSLSNIELLEC
Applicable Applications for anti-PMFBP1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa99-198 from human PMFBP1 (NP_112583) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PMFBP1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged PMFBP1 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-PMFBP1 antibody
May play a role in sperm morphology especially the sperm tail and consequently affect fertility. May also be involved in the general organization of cellular cytoskeleton.
Product Categories/Family for anti-PMFBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
119,033 Da
NCBI Official Full Name
PMFBP1 protein
NCBI Official Synonym Full Names
polyamine modulated factor 1 binding protein 1
NCBI Official Symbol
PMFBP1
NCBI Protein Information
polyamine-modulated factor 1-binding protein 1; PMF-1 binding protein
UniProt Protein Name
Polyamine-modulated factor 1-binding protein 1
UniProt Gene Name
PMFBP1
UniProt Synonym Gene Names
PMF-1-binding protein
UniProt Entry Name
PMFBP_HUMAN

Uniprot Description

Function: May play a role in sperm morphology especially the sperm tail and consequently affect fertility. May also be involved in the general organization of cellular cytoskeleton. Ref.7

Sequence caution: The sequence AAK15456.1 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The PMFBP1 pmfbp1 (Catalog #AAA649038) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PMFBP1 (Polyamine-modulated Factor 1-binding Protein 1, PMF-1-binding Protein, DKFZp434G131, FLJ40146) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PMFBP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the PMFBP1 pmfbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FHTEELQTSY YSLRQYQSIL EKQTSDLVLL HHHCKLKEDE VILYEEEMGN HNENTGEKLH LAQEQLALAG DKIASLERSL NLYRDKYQSS LSNIELLEC. It is sometimes possible for the material contained within the vial of "PMFBP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual