Mouse anti-Human PLXDC1 Monoclonal Antibody | anti-PLXDC1 antibody

PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (FITC)

Cat. Num. AAA6148925

• Gene Names: PLXDC1; TEM3; TEM7
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PLXDC1; Monoclonal Antibody; PLXDC1 (TEM3; TEM7; Plexin Domain-containing Protein 1; Tumor Endothelial Marker 3; Tumor Endothelial Marker 7; DKFZp686F0937; FLJ36270; FLJ45632) (FITC); anti-PLXDC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4B10
• Specificity: Recognizes human PLXDC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PLXDC1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa313-422 from human PLXDC1 (NP_065138) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGTP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(Western Blot analysis of PLXDC1 expression in transfected 293T cell line by PLXDC1 monoclonal antibody. Lane 1: PLXDC1 transfected lysate (55.778kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PLXDC1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of PLXDC1 over-expressed 293 cell line, cotransfected with PLXDC1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PLXDC1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-PLXDC1 antibody

Plays a critical role in endothelial cell capillary morphogenesis.

Product Categories/Family for anti-PLXDC1 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 15011862
• NCBI GeneID: 57125
• NCBI Accession #: NP_065138
• NCBI GenBank Nucleotide #: NM_020405
• UniProt Accession #: Q8IUK5
• Molecular Weight: 54kDa
• NCBI Official Full Name: plexin domain-containing protein 1
• NCBI Official Synonym Full Names: plexin domain containing 1
• NCBI Official Symbol: PLXDC1
• NCBI Official Synonym Symbols: TEM3; TEM7
• NCBI Protein Information: plexin domain-containing protein 1
• UniProt Protein Name: Plexin domain-containing protein 1
• Protein Family: Plexin domain-containing protein
• UniProt Gene Name: PLXDC1
• UniProt Synonym Gene Names: TEM3; TEM7
• UniProt Entry Name: PLDX1_HUMAN

Uniprot Description

PLXDC1: Plays a critical role in endothelial cell capillary morphogenesis. Belongs to the plexin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q21.1

Cellular Component: extracellular space; tight junction; cell soma; cytoplasm; dendrite; extracellular region; plasma membrane; integral to membrane; intracellular; receptor complex

Molecular Function: protein binding; receptor activity

Biological Process: spinal cord development; angiogenesis