Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PLEKHG5 Monoclonal Antibody | anti-PLEKHG5 antibody

PLEKHG5 (Pleckstrin Homology Domain Containing Family G Member 5, PH Domain-containing Family G Member 5, Guanine Nucleotide Exchange Factor 720, GEF720, KIAA0720) (MaxLight 650)

Gene Names
PLEKHG5; Syx; Tech; DSMA4; CMTRIC; GEF720
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLEKHG5; Monoclonal Antibody; PLEKHG5 (Pleckstrin Homology Domain Containing Family G Member 5; PH Domain-containing Family G Member 5; Guanine Nucleotide Exchange Factor 720; GEF720; KIAA0720) (MaxLight 650); anti-PLEKHG5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5A9
Specificity
Recognizes human PLEKHG5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
1006
Applicable Applications for anti-PLEKHG5 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa896-996 from human PLEKHG5 (NP_065682) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTL
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-PLEKHG5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
pleckstrin homology domain-containing family G member 5 isoform a
NCBI Official Synonym Full Names
pleckstrin homology and RhoGEF domain containing G5
NCBI Official Symbol
PLEKHG5
NCBI Official Synonym Symbols
Syx; Tech; DSMA4; CMTRIC; GEF720
NCBI Protein Information
pleckstrin homology domain-containing family G member 5
UniProt Protein Name
Pleckstrin homology domain-containing family G member 5
UniProt Gene Name
PLEKHG5
UniProt Synonym Gene Names
KIAA0720; PH domain-containing family G member 5; GEF720

NCBI Description

This gene encodes a protein that activates the nuclear factor kappa B (NFKB1) signaling pathway. Mutations in this gene are associated with autosomal recessive distal spinal muscular atrophy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]

Uniprot Description

PLEKHG5: Activates the NF-kappa-B signaling pathway and RHOA. Appears to be involved in the control of neuronal cell differentiation. Defects in PLEKHG5 are the cause of distal spinal muscular atrophy autosomal recessive type 4 (DSMA4). Distal spinal muscular atrophy, also known as distal hereditary motor neuronopathy, represents a heterogeneous group of neuromuscular disorders caused by selective degeneration of motor neurons in the anterior horn of the spinal cord, without sensory deficit in the posterior horn. The overall clinical picture consists of a classical distal muscular atrophy syndrome in the legs without clinical sensory loss. The disease starts with weakness and wasting of distal muscles of the anterior tibial and peroneal compartments of the legs. Later on, weakness and atrophy may expand to the proximal muscles of the lower limbs and/or to the distal upper limbs. DSMA4 is characterized by childhood onset, generalized muscle weakness and atrophy with denervation and normal sensation. Bulbar symptoms and pyramidal signs are absent. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1p36.31

Cellular Component: cytoplasm; cytosol; endocytic vesicle; intercellular junction; lamellipodium; perinuclear region of cytoplasm; plasma membrane

Molecular Function: guanyl-nucleotide exchange factor activity; Rho guanyl-nucleotide exchange factor activity; signal transducer activity

Biological Process: positive regulation of apoptosis; positive regulation of GTPase activity; positive regulation of I-kappaB kinase/NF-kappaB signaling; regulation of Rho protein signal transduction; regulation of small GTPase mediated signal transduction; signal transduction

Disease: Charcot-marie-tooth Disease, Recessive Intermediate C; Spinal Muscular Atrophy, Distal, Autosomal Recessive, 4

Research Articles on PLEKHG5

Similar Products

Product Notes

The PLEKHG5 plekhg5 (Catalog #AAA6223891) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLEKHG5 (Pleckstrin Homology Domain Containing Family G Member 5, PH Domain-containing Family G Member 5, Guanine Nucleotide Exchange Factor 720, GEF720, KIAA0720) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLEKHG5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLEKHG5 plekhg5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLEKHG5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.