Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PLDN Monoclonal Antibody | anti-PLDN antibody

PLDN (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 6, BLOC-1 Subunit 6, Pallid Protein Homolog, Pallidin, Syntaxin 13-interacting Protein, BLOC1S6, PA) (MaxLight 650)

Gene Names
BLOC1S6; PA; HPS9; PLDN; BLOS6; PALLID
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLDN; Monoclonal Antibody; PLDN (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 6; BLOC-1 Subunit 6; Pallid Protein Homolog; Pallidin; Syntaxin 13-interacting Protein; BLOC1S6; PA) (MaxLight 650); anti-PLDN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H8
Specificity
Recognizes human PLDN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-PLDN antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human PLDN (NP_036520) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSML*
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PLDN antibody
The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Product Categories/Family for anti-PLDN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21.9kDa (192aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
NCBI Official Full Name
biogenesis of lysosome-related organelles complex 1 subunit 6 isoform 2
NCBI Official Synonym Full Names
biogenesis of lysosomal organelles complex 1 subunit 6
NCBI Official Symbol
BLOC1S6
NCBI Official Synonym Symbols
PA; HPS9; PLDN; BLOS6; PALLID
NCBI Protein Information
biogenesis of lysosome-related organelles complex 1 subunit 6
UniProt Protein Name
Biogenesis of lysosome-related organelles complex 1 subunit 6
UniProt Gene Name
BLOC1S6
UniProt Synonym Gene Names
PA; PLDN; BLOC-1 subunit 6
UniProt Entry Name
BL1S6_HUMAN

NCBI Description

The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Mutations in this gene cause symptoms associated with Hermansky-Pudlak syndrome-9. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome. [provided by RefSeq, Aug 2015]

Uniprot Description

PLDN: Involved in the development of lysosome-related organelles, such as melanosomes and platelet-dense granules. May play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process. Defects in PLDN are the cause of Hermansky-Pudlak syndrome type 9 (HPS9). A form of Hermansky-Pudlak syndrome, a genetically heterogeneous autosomal recessive disorder characterized by oculocutaneous albinism, bleeding due to platelet storage pool deficiency, and lysosomal storage defects. This syndrome results from defects of diverse cytoplasmic organelles including melanosomes, platelet dense granules and lysosomes. Ceroid storage in the lungs is associated with pulmonary fibrosis, a common cause of premature death in individuals with HPS. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 15q21.1

Cellular Component: nucleoplasm; SNARE complex; transport vesicle; extrinsic to membrane; cytoplasm; cytosol; endosome

Molecular Function: actin filament binding; identical protein binding; protein binding; protein homodimerization activity; syntaxin binding

Biological Process: positive regulation of pigment cell differentiation; secretion of lysosomal enzymes; melanosome organization and biogenesis; anterograde synaptic vesicle transport; melanocyte differentiation; post-Golgi vesicle-mediated transport; anterograde axon cargo transport; blood coagulation; melanosome transport; positive regulation of natural killer cell activation; neurite development; synaptic vesicle docking during exocytosis

Disease: Hermansky-pudlak Syndrome 9

Research Articles on PLDN

Similar Products

Product Notes

The PLDN bloc1s6 (Catalog #AAA6223887) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLDN (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 6, BLOC-1 Subunit 6, Pallid Protein Homolog, Pallidin, Syntaxin 13-interacting Protein, BLOC1S6, PA) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLDN can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLDN bloc1s6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLDN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.