Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human, Mouse PKNOX2 Monoclonal Antibody | anti-PKNOX2 antibody

PKNOX2 (PREP2, Homeobox Protein PKNOX2, Homeobox Protein PREP-2, PBX/Knotted Homeobox 2, FLJ13074) APC

Gene Names
PKNOX2; PREP2
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PKNOX2; Monoclonal Antibody; PKNOX2 (PREP2; Homeobox Protein PKNOX2; Homeobox Protein PREP-2; PBX/Knotted Homeobox 2; FLJ13074) APC; anti-PKNOX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B6
Specificity
Recognizes human PKNOX2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PKNOX2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa116-216 from human PKNOX2 (NP_071345) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCFKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(PKNOX2 monoclonal antibody, Western Blot analysis of PKNOX2 expression in Hela NE.)

Western Blot (WB) (PKNOX2 monoclonal antibody, Western Blot analysis of PKNOX2 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of PKNOX2 expression in transfected 293T cell line by PKNOX2 monoclonal antibody. Lane 1: PKNOX2 transfected lysate (51.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PKNOX2 expression in transfected 293T cell line by PKNOX2 monoclonal antibody. Lane 1: PKNOX2 transfected lysate (51.9kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PKNOX2 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PKNOX2 on HeLa cell. [antibody concentration 10ug/ml].)

Western Blot (WB)

(Western blot analysis of PKNOX2 over-expressed 293 cell line, cotransfected with PKNOX2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PKNOX2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PKNOX2 over-expressed 293 cell line, cotransfected with PKNOX2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PKNOX2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(PKNOX2 monoclonal antibody. Western Blot analysis of PKNOX2 expression in NIH/3T3.)

Western Blot (WB) (PKNOX2 monoclonal antibody. Western Blot analysis of PKNOX2 expression in NIH/3T3.)
Product Categories/Family for anti-PKNOX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
homeobox protein PKNOX2
NCBI Official Synonym Full Names
PBX/knotted 1 homeobox 2
NCBI Official Symbol
PKNOX2
NCBI Official Synonym Symbols
PREP2
NCBI Protein Information
homeobox protein PKNOX2
Protein Family

NCBI Description

Homeodomain proteins are sequence-specific transcription factors that share a highly conserved DNA-binding domain and play fundamental roles in cell proliferation, differentiation, and death. PKNOX2 belongs to the TALE (3-amino acid loop extension) class of homeodomain proteins characterized by a 3-amino acid extension between alpha helices 1 and 2 within the homeodomain (Imoto et al., 2001 [PubMed 11549286]).[supplied by OMIM, Oct 2009]

Research Articles on PKNOX2

Similar Products

Product Notes

The PKNOX2 (Catalog #AAA6138288) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PKNOX2 (PREP2, Homeobox Protein PKNOX2, Homeobox Protein PREP-2, PBX/Knotted Homeobox 2, FLJ13074) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PKNOX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PKNOX2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PKNOX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.