Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MUC12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

Rabbit anti-Human MUC12 Polyclonal Antibody | anti-MUC12 antibody

MUC12 antibody - middle region

Gene Names
MUC12; MUC11; MUC-11; MUC-12
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MUC12; Polyclonal Antibody; MUC12 antibody - middle region; anti-MUC12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTH
Sequence Length
748
Applicable Applications for anti-MUC12 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MUC12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MUC12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-MUC12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)
Related Product Information for anti-MUC12 antibody
This is a rabbit polyclonal antibody against MUC12. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MUC12 is involved in epithelial cell protection, adhesion modulation, and signaling. It may be involved in epithelial cell growth regulation. The protein is stimulated by both cytokine TNF-alpha and TGF-beta in intestinal epithelium.
Product Categories/Family for anti-MUC12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Synonym Full Names
mucin 12, cell surface associated
NCBI Official Symbol
MUC12
NCBI Official Synonym Symbols
MUC11; MUC-11; MUC-12
NCBI Protein Information
mucin-12
UniProt Protein Name
Mucin-12
Protein Family
UniProt Gene Name
MUC12
UniProt Synonym Gene Names
MUC11
UniProt Entry Name
MUC12_HUMAN

NCBI Description

This gene encodes an integral membrane glycoprotein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces and have been implicated in epithelial renewal and differentiation. These glycoproteins also play a role in intracellular signaling. This protein is expressed on the apical membrane surface of epithelial cells that line the mucosal surfaces of many different tissues including the colon, pancreas, prostate, and uterus. The expression of this gene is downregulated in colorectal cancer tissue. [provided by RefSeq, Apr 2017]

Uniprot Description

MUC12: Involved in epithelial cell protection, adhesion modulation, and signaling. May be involved in epithelial cell growth regulation. Stimulated by both cytokine TNF-alpha and TGF- beta in intestinal epithelium.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: Golgi lumen; integral to plasma membrane

Biological Process: protein amino acid O-linked glycosylation; cellular protein metabolic process; O-glycan processing; regulation of cell growth; post-translational protein modification

Research Articles on MUC12

Similar Products

Product Notes

The MUC12 muc12 (Catalog #AAA3207802) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MUC12 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MUC12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MUC12 muc12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSVLVGDSTP SPISSGSMET TALPGSTTKP GLSEKSTTFY SSPRSPDTTH. It is sometimes possible for the material contained within the vial of "MUC12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.