Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PITX1 monoclonal antibody (M02), clone 6D4 Western Blot analysis of PITX1 expression in A-431 (Cat # L015V1).)

Mouse PITX1 Monoclonal Antibody | anti-PITX1 antibody

PITX1 (Paired-like Homeodomain 1, BFT, POTX, PTX1) (FITC)

Gene Names
PITX1; BFT; CCF; POTX; PTX1; LBNBG
Applications
Western Blot
Purity
Purified
Synonyms
PITX1; Monoclonal Antibody; PITX1 (Paired-like Homeodomain 1; BFT; POTX; PTX1) (FITC); Paired-like Homeodomain 1; PTX1; anti-PITX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D4
Specificity
Recognizes PITX1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PITX1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PITX1 (NP_002644, 225aa-313aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PITX1 monoclonal antibody (M02), clone 6D4 Western Blot analysis of PITX1 expression in A-431 (Cat # L015V1).)

Western Blot (WB) (PITX1 monoclonal antibody (M02), clone 6D4 Western Blot analysis of PITX1 expression in A-431 (Cat # L015V1).)

Testing Data

(Detection limit for recombinant GST tagged PITX1 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PITX1 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-PITX1 antibody
This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. [provided by RefSeq]
Product Categories/Family for anti-PITX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
pituitary homeobox 1
NCBI Official Synonym Full Names
paired like homeodomain 1
NCBI Official Symbol
PITX1
NCBI Official Synonym Symbols
BFT; CCF; POTX; PTX1; LBNBG
NCBI Protein Information
pituitary homeobox 1
UniProt Protein Name
Pituitary homeobox 1
Protein Family
UniProt Gene Name
PITX1
UniProt Synonym Gene Names
BFT; PTX1
UniProt Entry Name
PITX1_HUMAN

NCBI Description

This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. [provided by RefSeq, Jul 2008]

Uniprot Description

PITX1: May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb. Defects in PITX1 are a cause of congenital clubfoot (CCF); also known as talipes equinovarus (TEV). Clubfoot is a congenital limb deformity defined as fixation of the foot in cavus, adductus, varus, and equinus (i.e. inclined inwards, axially rotated outwards, and pointing downwards) with concomitant soft tissue abnormalities. Clubfoot may occur in isolation or as part of a syndrome. Clubfoot appears to be a multifactorial trait. Belongs to the paired homeobox family. Bicoid subfamily.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: transcription factor complex; cytoplasm; nucleolus; nucleus

Biological Process: myoblast cell fate commitment; anatomical structure morphogenesis; transcription, DNA-dependent; pituitary gland development; cartilage development; branchiomeric skeletal muscle development; positive regulation of transcription from RNA polymerase II promoter; skeletal development; embryonic hindlimb morphogenesis

Disease: Liebenberg Syndrome; Clubfoot, Congenital, With Or Without Deficiency Of Long Bones And/or Mirror-image Polydactyly

Research Articles on PITX1

Similar Products

Product Notes

The PITX1 pitx1 (Catalog #AAA6175651) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PITX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PITX1 pitx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PITX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.