Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)

Mouse anti-Human PIPOX Monoclonal Antibody | anti-PIPOX antibody

PIPOX (Peroxisomal Sarcosine Oxidase, PSO, L-pipecolate Oxidase, L-pipecolic Acid Oxidase, LPIPOX, PSO)

Gene Names
PIPOX; LPIPOX
Reactivity
Human
Applications
ELISA, Western Blot, Immunoprecipitation
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PIPOX; Monoclonal Antibody; PIPOX (Peroxisomal Sarcosine Oxidase; PSO; L-pipecolate Oxidase; L-pipecolic Acid Oxidase; LPIPOX; PSO); Anti -PIPOX (Peroxisomal Sarcosine Oxidase; anti-PIPOX antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D1
Specificity
Recognizes human PIPOX.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
IGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLAPFRISRFPG
Applicable Applications for anti-PIPOX antibody
ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in ELISA, Western Blot and Immunoprecipitation.
Immunogen
Partial recombinant corresponding to aa292-384 from human PIPOX (AAH27622.1) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.23kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)

Western Blot (WB)

(Western Blot analysis of PIPOX expression in transfected 293T cell line by PIPOX monoclonal antibody.|Lane 1: PIPOX transfected lysate (44.1kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PIPOX expression in transfected 293T cell line by PIPOX monoclonal antibody.|Lane 1: PIPOX transfected lysate (44.1kD).|Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of PIPOX transfected lysate using PIPOX monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PIPOX rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of PIPOX transfected lysate using PIPOX monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PIPOX rabbit polyclonal antibody.)
Related Product Information for anti-PIPOX antibody
Metabolizes sarcosine, L-pipecolic acid and L-proline.
Product Categories/Family for anti-PIPOX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
44,108 Da
NCBI Official Full Name
PIPOX
NCBI Official Synonym Full Names
pipecolic acid oxidase
NCBI Official Symbol
PIPOX
NCBI Official Synonym Symbols
LPIPOX
NCBI Protein Information
peroxisomal sarcosine oxidase; PSO; L-pipecolate oxidase; L-pipecolic acid oxidase
UniProt Protein Name
PIPOX protein
UniProt Gene Name
PIPOX
UniProt Entry Name
Q6IAJ9_HUMAN

Uniprot Description

PIPOX: Metabolizes sarcosine, L-pipecolic acid and L-proline. Belongs to the MSOX/MTOX family.

Protein type: Amino Acid Metabolism - glycine, serine and threonine; EC 1.5.3.7; EC 1.5.3.1; Amino Acid Metabolism - lysine degradation; Oxidoreductase

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: peroxisome

Molecular Function: L-pipecolate oxidase activity; sarcosine oxidase activity; receptor binding

Biological Process: tetrahydrofolate metabolic process; L-lysine catabolic process to acetyl-CoA via L-pipecolate

Research Articles on PIPOX

Similar Products

Product Notes

The PIPOX pipox (Catalog #AAA648058) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIPOX (Peroxisomal Sarcosine Oxidase, PSO, L-pipecolate Oxidase, L-pipecolic Acid Oxidase, LPIPOX, PSO) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIPOX can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP). Suitable for use in ELISA, Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the PIPOX pipox for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IGDVQILSSF VRDHLPDLKP EPAVIESCMY TNTPDEQFIL DRHPKYDNIV IGAGFSGHGF KLAPVVGKIL YELSMKLTPS YDLAPFRISR FPG. It is sometimes possible for the material contained within the vial of "PIPOX, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.