Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PIP5K3 is 0.1 ng/ml as a capture antibody.)

Mouse PIP5K3 Monoclonal Antibody | anti-PIP5K3 antibody

PIP5K3 (Phosphatidylinositol-3-Phosphate/Phosphatidylinositol 5-Kinase, Type III, CFD, FAB1, KIAA0981, MGC40423, PIKFYVE, PIP5K) (FITC)

Gene Names
PIKFYVE; CFD; FAB1; HEL37; PIP5K; PIP5K3; ZFYVE29
Applications
Western Blot
Purity
Purified
Synonyms
PIP5K3; Monoclonal Antibody; PIP5K3 (Phosphatidylinositol-3-Phosphate/Phosphatidylinositol 5-Kinase; Type III; CFD; FAB1; KIAA0981; MGC40423; PIKFYVE; PIP5K) (FITC); Phosphatidylinositol-3-Phosphate/Phosphatidylinositol 5-Kinase; PIP5K; anti-PIP5K3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D11
Specificity
Recognizes PIP5K3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
451
Applicable Applications for anti-PIP5K3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PIP5K3 (NP_689884, 342aa-451aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PIP5K3 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIP5K3 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-PIP5K3 antibody
PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]). [supplied by OMIM]
Product Categories/Family for anti-PIP5K3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
1-phosphatidylinositol 3-phosphate 5-kinase isoform 3
NCBI Official Synonym Full Names
phosphoinositide kinase, FYVE-type zinc finger containing
NCBI Official Symbol
PIKFYVE
NCBI Official Synonym Symbols
CFD; FAB1; HEL37; PIP5K; PIP5K3; ZFYVE29
NCBI Protein Information
1-phosphatidylinositol 3-phosphate 5-kinase
UniProt Protein Name
1-phosphatidylinositol 3-phosphate 5-kinase
UniProt Gene Name
PIKFYVE
UniProt Synonym Gene Names
KIAA0981; PIP5K3; Phosphatidylinositol 3-phosphate 5-kinase; PIPkin-III
UniProt Entry Name
FYV1_HUMAN

NCBI Description

Phosphorylated derivatives of phosphatidylinositol (PtdIns) regulate cytoskeletal functions, membrane trafficking, and receptor signaling by recruiting protein complexes to cell- and endosomal-membranes. Humans have multiple PtdIns proteins that differ by the degree and position of phosphorylation of the inositol ring. This gene encodes an enzyme (PIKfyve; also known as phosphatidylinositol-3-phosphate 5-kinase type III or PIPKIII) that phosphorylates the D-5 position in PtdIns and phosphatidylinositol-3-phosphate (PtdIns3P) to make PtdIns5P and PtdIns(3,5)biphosphate. The D-5 position also can be phosphorylated by type I PtdIns4P-5-kinases (PIP5Ks) that are encoded by distinct genes and preferentially phosphorylate D-4 phosphorylated PtdIns. In contrast, PIKfyve preferentially phosphorylates D-3 phosphorylated PtdIns. In addition to being a lipid kinase, PIKfyve also has protein kinase activity. PIKfyve regulates endomembrane homeostasis and plays a role in the biogenesis of endosome carrier vesicles from early endosomes. Mutations in this gene cause corneal fleck dystrophy (CFD); an autosomal dominant disorder characterized by numerous small white flecks present in all layers of the corneal stroma. Histologically, these flecks appear to be keratocytes distended with lipid and mucopolysaccharide filled intracytoplasmic vacuoles. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, May 2010]

Uniprot Description

PIKFYVE: The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Catalyzes the phosphorylation of phosphatidylinositol 3-phosphate on the fifth hydroxyl of the myo- inositol ring, to form phosphatidylinositol 3,5-bisphosphate. Required for endocytic-vacuolar pathway and nuclear migration. Plays a role in the biogenesis of endosome carrier vesicles (ECV)/ multivesicular bodies (MVB) transport intermediates from early endosomes. Defects in PIKFYVE are the cause of corneal fleck dystrophy (CFD). CFD is an autosomal dominant disorder of the cornea characterized by numerous small white flecks scattered in all levels of the stroma. Although CFD may occasionally cause mild photophobia, patients are typically asymptomatic and have normal vision. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, lipid; Carbohydrate Metabolism - inositol phosphate; Motility/polarity/chemotaxis; EC 2.7.1.150

Chromosomal Location of Human Ortholog: 2q34

Cellular Component: Golgi membrane; perinuclear region of cytoplasm; early endosome membrane; late endosome membrane; endosome membrane; cytoplasmic vesicle; intercellular junction; cytosol; lipid raft

Molecular Function: protein binding; 1-phosphatidylinositol-3-phosphate 5-kinase activity; 1-phosphatidylinositol-4-phosphate 5-kinase activity; phosphatidylinositol-3,5-bisphosphate 5-phosphatase activity; metal ion binding; ATP binding

Biological Process: myelin formation; receptor-mediated endocytosis; cellular protein metabolic process; phosphoinositide phosphorylation; phospholipid metabolic process; phosphatidylinositol biosynthetic process; retrograde transport, endosome to Golgi

Disease: Corneal Dystrophy, Fleck

Research Articles on PIP5K3

Similar Products

Product Notes

The PIP5K3 pikfyve (Catalog #AAA6178451) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PIP5K3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIP5K3 pikfyve for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIP5K3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.