Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)

Mouse anti-Human PIP5K1C Monoclonal Antibody | anti-PIP5K1C antibody

PIP5K1C (KIAA0589, Phosphatidylinositol 4-phosphate 5-kinase Type-1 gamma, Phosphatidylinositol 4-phosphate 5-kinase Type I gamma) APC

Gene Names
PIP5K1C; LCCS3; PIP5Kgamma; PIP5K-GAMMA; PIP5K1-gamma
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIP5K1C; Monoclonal Antibody; PIP5K1C (KIAA0589; Phosphatidylinositol 4-phosphate 5-kinase Type-1 gamma; Phosphatidylinositol 4-phosphate 5-kinase Type I gamma) APC; anti-PIP5K1C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
7D11
Specificity
Recognizes human PIP5K1C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
668
Applicable Applications for anti-PIP5K1C antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa561-668 from PIP5K1C (NP_036530) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEASPAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYFPTDERSWVYSPLHYSAQAPPASDGESD*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.88kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)

Testing Data

(Detection limit for recombinant GST tagged PIP5K1C is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIP5K1C is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-PIP5K1C antibody
This locus encodes a type I phosphatidylinositol 4-phosphate 5-kinase. The encoded protein catalyzes phosphorylation of phosphatidylinositol 4-phosphate, producing phosphatidylinositol 4,5-bisphosphate. This enzyme is found at synapses and has been found to play roles in endocytosis and cell migration. Mutations at this locus have been associated with lethal congenital contractural syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.
Product Categories/Family for anti-PIP5K1C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
phosphatidylinositol 4-phosphate 5-kinase type-1 gamma isoform 2
NCBI Official Synonym Full Names
phosphatidylinositol-4-phosphate 5-kinase type 1 gamma
NCBI Official Symbol
PIP5K1C
NCBI Official Synonym Symbols
LCCS3; PIP5Kgamma; PIP5K-GAMMA; PIP5K1-gamma
NCBI Protein Information
phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
UniProt Protein Name
Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
UniProt Gene Name
PIP5K1C
UniProt Synonym Gene Names
KIAA0589; PIP5K1-gamma; PtdIns(4)P-5-kinase 1 gamma; PIP5KIgamma
UniProt Entry Name
PI51C_HUMAN

NCBI Description

This locus encodes a type I phosphatidylinositol 4-phosphate 5-kinase. The encoded protein catalyzes phosphorylation of phosphatidylinositol 4-phosphate, producing phosphatidylinositol 4,5-bisphosphate. This enzyme is found at synapses and has been found to play roles in endocytosis and cell migration. Mutations at this locus have been associated with lethal congenital contractural syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Sep 2010]

Uniprot Description

PIP5K1C: a member of the type I phosphatidylinositol-4-phosphate 5-kinase family of enzymes. A similar protein in mice is found in synapses and focal adhesion plaques, and binds the FERM domain of talin through its C-terminus.

Protein type: Kinase, lipid; Motility/polarity/chemotaxis; EC 2.7.1.68; Carbohydrate Metabolism - inositol phosphate

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: focal adhesion; endomembrane system; uropod; cytosol; nucleus; phagocytic cup

Molecular Function: protein binding; 1-phosphatidylinositol-4-phosphate 5-kinase activity; ATP binding

Biological Process: neutrophil chemotaxis; axon guidance; synaptic vesicle exocytosis; cell-cell adhesion; phosphoinositide phosphorylation; cytoskeletal anchoring; phospholipid metabolic process; synaptic vesicle endocytosis; phosphatidylinositol biosynthetic process; actin cytoskeleton organization and biogenesis; phagocytosis

Disease: Lethal Congenital Contracture Syndrome 3

Research Articles on PIP5K1C

Similar Products

Product Notes

The PIP5K1C pip5k1c (Catalog #AAA6138269) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIP5K1C (KIAA0589, Phosphatidylinositol 4-phosphate 5-kinase Type-1 gamma, Phosphatidylinositol 4-phosphate 5-kinase Type I gamma) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIP5K1C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIP5K1C pip5k1c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIP5K1C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.