Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PPP4R1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PPP4R1 Polyclonal Antibody | anti-PPP4R1 antibody

PPP4R1 Antibody - middle region

Gene Names
PPP4R1; MEG1; PP4R1; PP4(Rmeg)
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PPP4R1; Polyclonal Antibody; PPP4R1 Antibody - middle region; anti-PPP4R1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESEGPVPSSPNITMAT
Sequence Length
950
Applicable Applications for anti-PPP4R1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPP4R1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PPP4R1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP4R1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PPP4R1 antibody
This gene encodes one of several alternate regulatory subunits of serine/threonine protein phosphatase 4 (PP4). The protein features multiple HEAT repeats. This protein forms a complex with PP4RC. This complex may have a distinct role from other PP4 complexes, including regulation of HDAC3. There is also a transcribed pseudogene on chromosome 20. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-PPP4R1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107 kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 4 regulatory subunit 1 isoform a
NCBI Official Synonym Full Names
protein phosphatase 4 regulatory subunit 1
NCBI Official Symbol
PPP4R1
NCBI Official Synonym Symbols
MEG1; PP4R1; PP4(Rmeg)
NCBI Protein Information
serine/threonine-protein phosphatase 4 regulatory subunit 1
UniProt Protein Name
Serine/threonine-protein phosphatase 4 regulatory subunit 1
UniProt Gene Name
PPP4R1
UniProt Synonym Gene Names
MEG1; PP4R1
UniProt Entry Name
PP4R1_HUMAN

NCBI Description

This gene encodes one of several alternate regulatory subunits of serine/threonine protein phosphatase 4 (PP4). The protein features multiple HEAT repeats. This protein forms a complex with PP4RC. This complex may have a distinct role from other PP4 complexes, including regulation of HDAC3 (Zhang et al., PMID: 15805470). There is also a transcribed pseudogene on chromosome 20. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]

Research Articles on PPP4R1

Similar Products

Product Notes

The PPP4R1 ppp4r1 (Catalog #AAA3222248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP4R1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP4R1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP4R1 ppp4r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSFHFWRTPL PEIDLDIELE QNSGGKPSPE GPEEESEGPV PSSPNITMAT. It is sometimes possible for the material contained within the vial of "PPP4R1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.