Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human PIN1 Monoclonal Antibody | anti-PIN1 antibody

PIN1 (Peptidyl-prolyl Cis-trans Isomerase NIMA-interacting 1, Peptidyl-prolyl Cis-trans Isomerase Pin1, PPIase Pin1, Rotamase Pin1) (Biotin)

Gene Names
PIN1; DOD; UBL5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIN1; Monoclonal Antibody; PIN1 (Peptidyl-prolyl Cis-trans Isomerase NIMA-interacting 1; Peptidyl-prolyl Cis-trans Isomerase Pin1; PPIase Pin1; Rotamase Pin1) (Biotin); anti-PIN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2F2
Specificity
Recognizes human PIN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PIN1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa64-163 from human PIN1 (AAH02899) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(PIN1 monoclonal antibody. Western Blot analysis of PIN1 expression in Jurkat)

Western Blot (WB) (PIN1 monoclonal antibody. Western Blot analysis of PIN1 expression in Jurkat)
Related Product Information for anti-PIN1 antibody
Pin-1 is a the peptidylprolyl cis/trans isomerase enzyme which is responsible, as its name suggests, for flipping the proline ring from the cis to the trans conformation. This enzyme is heavily upregulated in tumor cells, so that antibodies to this protein can be used as tumor markers. Pin-1 protein is concentrated in the nucleus in small punctate structures and is particularly obvious in tumor cells. The HGNC name for this protein is Pin-1.
Product Categories/Family for anti-PIN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
18,243 Da
NCBI Official Full Name
Homo sapiens peptidylprolyl cis/trans isomerase, NIMA-interacting 1, mRNA
NCBI Official Synonym Full Names
peptidylprolyl cis/trans isomerase, NIMA-interacting 1
NCBI Official Symbol
PIN1
NCBI Official Synonym Symbols
DOD; UBL5
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

NCBI Description

Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jun 2011]

Research Articles on PIN1

Similar Products

Product Notes

The PIN1 (Catalog #AAA6143570) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIN1 (Peptidyl-prolyl Cis-trans Isomerase NIMA-interacting 1, Peptidyl-prolyl Cis-trans Isomerase Pin1, PPIase Pin1, Rotamase Pin1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIN1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIN1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.